(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE213

ASFUM1_4.PE213       Location/Qualifiers
FT   CDS             complement(952507..955101)
FT                   /codon_start=1
FT                   /gene_family="HOG000171322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258995"
FT                   /orf_name="AFUA_4G03340"
FT                   /product="DUF1212 domain membrane protein "
FT                   /protein_id="EAL84483.1"
FT                   /db_xref="HOGENOM:HBG124694"
FT                   /db_xref="HOGENOM:HBG324120"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniParc:UPI000051FB42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y0"
FT                   /transl_table=1
FT                   /translation="MSDSRQGSESSAATYHSQPESENTQDSVGPESPGSPPAPPGSPRS
FT                   PEQQSQDGDNQEIPNIETTPKSGENGEGSQKRQRVRFRSAISVDYPQPGGPESSEDERS
FT                   IQEKQKAQRDQAQRQGQPHLMSTPYVHGSLDVTETPLKERTTQEDLQQAEKTPVDKKPD
FT                   GIGAAAAVGDVSRTAKDKLRWLWDTVHGKLSKWSDRLGRPERGGDDLGPGVYHNEWTSG
FT                   GNAPLGDLTDNKHKTHEEKKSHQATSTSEAHRLVRELTQDQSGNRRKTRGKPYPHTDTQ
FT                   GGQGGQGNNAIESGLRYRAGGGGVLAQLMKLNGGMQQGGQAGQAGQGGQRSPSDTGTSG
FT                   TTTPKKEKLKWYKNKQHTRSTSTLVGASGSMSGASTPVSSEVLSAASKRLGGQQFQQGG
FT                   RMRLEDEIQVTVQIAEIIARQRYIMQLCKALMTFGAPTHRLEEYMQMTAKVLEVDSQYL
FT                   YFPGCMIMSFDDPSTRTTEVKLVRVAQGINLQKLANTHRIYKNVVHDVIGVEEAIQELE
FT                   DIQKKPPRFNKWIVVLVYGLASATVGPFAFNARPIDMPIIFFNGCLLGLMQQVFAPRSA
FT                   LYSNVFEVTAAVLTSFLARAFGSIPKAVIDGKRQFLFCFSAIAQSSIALILPGFLVLCS
FT                   SLELQSHQIIAGSIRMVYAIIYSLFLGYGITVGTTIYGLMDPSAVSDIQCPKAGAFKNP
FT                   YLQRFPFVAIMTVWLLIINQGKWKQLPVMSTIAMSGYITNYFSTKRLGSNSQVANTVGA
FT                   FTIGIMGNLYSRLWHGHAATAILPAILVLVPSGLAASGSLITGVASADQIRHNISSPSG
FT                   TSQPGAGLSTNSSVWTLAVGMVQVAIGITVGLFIAALVVYPYGKRRSGLFSF"
     MSDSRQGSES SAATYHSQPE SENTQDSVGP ESPGSPPAPP GSPRSPEQQS QDGDNQEIPN        60
     IETTPKSGEN GEGSQKRQRV RFRSAISVDY PQPGGPESSE DERSIQEKQK AQRDQAQRQG       120
     QPHLMSTPYV HGSLDVTETP LKERTTQEDL QQAEKTPVDK KPDGIGAAAA VGDVSRTAKD       180
     KLRWLWDTVH GKLSKWSDRL GRPERGGDDL GPGVYHNEWT SGGNAPLGDL TDNKHKTHEE       240
     KKSHQATSTS EAHRLVRELT QDQSGNRRKT RGKPYPHTDT QGGQGGQGNN AIESGLRYRA       300
     GGGGVLAQLM KLNGGMQQGG QAGQAGQGGQ RSPSDTGTSG TTTPKKEKLK WYKNKQHTRS       360
     TSTLVGASGS MSGASTPVSS EVLSAASKRL GGQQFQQGGR MRLEDEIQVT VQIAEIIARQ       420
     RYIMQLCKAL MTFGAPTHRL EEYMQMTAKV LEVDSQYLYF PGCMIMSFDD PSTRTTEVKL       480
     VRVAQGINLQ KLANTHRIYK NVVHDVIGVE EAIQELEDIQ KKPPRFNKWI VVLVYGLASA       540
     TVGPFAFNAR PIDMPIIFFN GCLLGLMQQV FAPRSALYSN VFEVTAAVLT SFLARAFGSI       600
     PKAVIDGKRQ FLFCFSAIAQ SSIALILPGF LVLCSSLELQ SHQIIAGSIR MVYAIIYSLF       660
     LGYGITVGTT IYGLMDPSAV SDIQCPKAGA FKNPYLQRFP FVAIMTVWLL IINQGKWKQL       720
     PVMSTIAMSG YITNYFSTKR LGSNSQVANT VGAFTIGIMG NLYSRLWHGH AATAILPAIL       780
     VLVPSGLAAS GSLITGVASA DQIRHNISSP SGTSQPGAGL STNSSVWTLA VGMVQVAIGI       840
     TVGLFIAALV VYPYGKRRSG LFSF                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page