(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE22

ASFUM1_4.PE22        Location/Qualifiers
FT   CDS             join(complement(88689..89040),complement(87620..88653))
FT                   /codon_start=1
FT                   /gene_family="HOG000216784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273684"
FT                   /orf_name="AFUA_4G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84385.1"
FT                   /db_xref="HOGENOM:HBG054294"
FT                   /db_xref="HOGENOM:HBG324393"
FT                   /db_xref="UniParc:UPI000051F4D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W956"
FT                   /transl_table=1
FT                   /translation="MAQKVPNPTPGSNSTLLRRKPEGTHSQGITSHQVGIAWSWFLVTV
FT                   PIAALTAVFLVLVFHYRLYHGDPPFPNLRLPSAEDEKNVVYVDLSSSMILFTTSWASSV
FT                   APMLSSFVVALASSQATVYTYVDPDQTSYTYLGVPETASLLTQGFTAKTYGARTQCQLI
FT                   SSKCTLQNAASSVKFNCSADFTGLINTPTLQAAFFEDESMSKNLRGKVVSNCSTGNPDY
FT                   FALASVVNLSGGKTPNSTEFVKSLHGVPTYVLGCHTTIYDIEYDRLNNTVTRFQPAASN
FT                   TSVSNIWQTSISQTQDWFPFFQQAAGTAIFSDTAEEFAEKVALALSKATIALGADALGA
FT                   QPALAAQDRETLLVARIPVAPLVAMVAVCLLYVVCGLVLTGIAAWSARYEVRDVQARLS
FT                   IAGLVADRFEEPGLRSDANCVEEMFAEHAGQESKRIAIESVDGVGVYRYTTWPKPEGSA
FT                   SGW"
     MAQKVPNPTP GSNSTLLRRK PEGTHSQGIT SHQVGIAWSW FLVTVPIAAL TAVFLVLVFH        60
     YRLYHGDPPF PNLRLPSAED EKNVVYVDLS SSMILFTTSW ASSVAPMLSS FVVALASSQA       120
     TVYTYVDPDQ TSYTYLGVPE TASLLTQGFT AKTYGARTQC QLISSKCTLQ NAASSVKFNC       180
     SADFTGLINT PTLQAAFFED ESMSKNLRGK VVSNCSTGNP DYFALASVVN LSGGKTPNST       240
     EFVKSLHGVP TYVLGCHTTI YDIEYDRLNN TVTRFQPAAS NTSVSNIWQT SISQTQDWFP       300
     FFQQAAGTAI FSDTAEEFAE KVALALSKAT IALGADALGA QPALAAQDRE TLLVARIPVA       360
     PLVAMVAVCL LYVVCGLVLT GIAAWSARYE VRDVQARLSI AGLVADRFEE PGLRSDANCV       420
     EEMFAEHAGQ ESKRIAIESV DGVGVYRYTT WPKPEGSASG W                           461
//

If you have problems or comments...

PBIL Back to PBIL home page