(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE220

ASFUM1_4.PE220       Location/Qualifiers
FT   CDS             join(970475..970760,970826..971118)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206307"
FT                   /orf_name="AFUA_4G03420"
FT                   /product="L-PSP endoribonuclease family protein, putative "
FT                   /protein_id="EAL84491.1"
FT                   /db_xref="HOGENOM:HBG054381"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000520424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X2"
FT                   /transl_table=1
FT                   /translation="MFHIRDIIYSRILHEYSSAEYIFRYSNIKATNSIKLQNYKTTKLQ
FT                   NYKTTKLQYNYVKMSHLTYYNYDGVGKAKQAQFKYSQAVRVGDRIECAGQGGWNPSTGT
FT                   IPRDINAQIDQAFANVDLNLRNAGGAGWSQVYRVNSYHVPINDEALEAMVRNFRKWVPG
FT                   HEPIWTCVGVTRLGEDDMRVEIEVVAHVP"
     MFHIRDIIYS RILHEYSSAE YIFRYSNIKA TNSIKLQNYK TTKLQNYKTT KLQYNYVKMS        60
     HLTYYNYDGV GKAKQAQFKY SQAVRVGDRI ECAGQGGWNP STGTIPRDIN AQIDQAFANV       120
     DLNLRNAGGA GWSQVYRVNS YHVPINDEAL EAMVRNFRKW VPGHEPIWTC VGVTRLGEDD       180
     MRVEIEVVAH VP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page