(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE222

ASFUM1_4.PE222       Location/Qualifiers
FT   CDS             join(complement(974204..974273),complement(973787..974143),
FT                   complement(973613..973740))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258999"
FT                   /orf_name="AFUA_4G03435"
FT                   /product="Formate/nitrite transporter family protein,
FT                   putative"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27182.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI0000F51A9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA66"
FT                   /transl_table=1
FT                   /translation="MLRPRSPWGNLAGSLFVVAIIFGYGNVFAADPYKSEVIAFATKKQ
FT                   LTPDFHQIFLRGIGCNWLVCLACFLGVQGRDLASKVVGIWFPTFAFVSLGFDHLVANMT
FT                   FIPLAIWLGAPKITVALYIWKGIIPTLLGNIIGGGLFVATYYWYMYLVSGEMATLTGMR
FT                   QSATTTPRSLDIEAMAAEKQN"
     MLRPRSPWGN LAGSLFVVAI IFGYGNVFAA DPYKSEVIAF ATKKQLTPDF HQIFLRGIGC        60
     NWLVCLACFL GVQGRDLASK VVGIWFPTFA FVSLGFDHLV ANMTFIPLAI WLGAPKITVA       120
     LYIWKGIIPT LLGNIIGGGL FVATYYWYMY LVSGEMATLT GMRQSATTTP RSLDIEAMAA       180
     EKQN                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page