(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE223

ASFUM1_4.PE223       Location/Qualifiers
FT   CDS             join(975430..976106,976167..976620)
FT                   /codon_start=1
FT                   /gene_family="HOG000159139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259000"
FT                   /orf_name="AFUA_4G03440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84493.1"
FT                   /db_xref="HOGENOM:HBG054383"
FT                   /db_xref="HOGENOM:HBG670383"
FT                   /db_xref="UniParc:UPI0000520209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X0"
FT                   /transl_table=1
FT                   /translation="MKSIFALTGLLSLVLSASAADPRLCPKGNDPLPASAFTLQQSKDN
FT                   SHLASLSHIFSVAGKNVSIARVLDSANRDLAKGKPPVGTTPVEAWKWNPGDMATKKWVP
FT                   QGITGSADASASGKWDGREMWLVSWHRDDDKSVRVSFVDRKTHKYRHVLLVEPTADDNF
FT                   AAVPVHAGGIAWYGEWLYVVDTSHGIRVFDLGQIWQVEDGDDVGKKGGKYSAAGYLYVL
FT                   PQIRSYKWTPGSSSPFRFSWISVDRSDNTLLVGEFIRDSSKDPIRLVKYPLDTNSGKLK
FT                   TNDKSIVTATFAHCADFLRMQGGFSYDNTFYISRSNGRSPKAGDMFKWKPGKPAELRNR
FT                   WFMAGNEDLSYNKVRKEYYTVSEYDGERFILAYNKM"
     MKSIFALTGL LSLVLSASAA DPRLCPKGND PLPASAFTLQ QSKDNSHLAS LSHIFSVAGK        60
     NVSIARVLDS ANRDLAKGKP PVGTTPVEAW KWNPGDMATK KWVPQGITGS ADASASGKWD       120
     GREMWLVSWH RDDDKSVRVS FVDRKTHKYR HVLLVEPTAD DNFAAVPVHA GGIAWYGEWL       180
     YVVDTSHGIR VFDLGQIWQV EDGDDVGKKG GKYSAAGYLY VLPQIRSYKW TPGSSSPFRF       240
     SWISVDRSDN TLLVGEFIRD SSKDPIRLVK YPLDTNSGKL KTNDKSIVTA TFAHCADFLR       300
     MQGGFSYDNT FYISRSNGRS PKAGDMFKWK PGKPAELRNR WFMAGNEDLS YNKVRKEYYT       360
     VSEYDGERFI LAYNKM                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page