(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE224

ASFUM1_4.PE224       Location/Qualifiers
FT   CDS             join(976914..977174,977243..977920)
FT                   /codon_start=1
FT                   /gene_family="HOG000171278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259001"
FT                   /orf_name="AFUA_4G03450"
FT                   /product="NmrA-like family protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054384"
FT                   /db_xref="HOGENOM:HBG327460"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F3E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W9"
FT                   /transl_table=1
FT                   /translation="MSQKIGIFPASGGLGTSIINHLVKLVPASQLILIARNPEKLASFS
FT                   RDGATIRRADYDDRASLERVFDGVGVLMLISYASFEIQHRVEAHKAAIDAARRSGVKHI
FT                   FYSSLAFAGDLGESSLAHVMGAHLATEKYLAELPGHFTYTAIREGLYSESFPIYTAWFD
FT                   PHQPVEEITIPHPGTGPGVAWAKRDELGEATAKMIYAYAKNTAGFPYLNRVVLLSGPRE
FT                   VSLAETAEVLGRAVGKPVRIREISVDEYVALPQIGDKHTYHGLNLSREWATAWAAIRAG
FT                   ETAVVSPLLGEILGREPEDFETTIRALVGAR"
     MSQKIGIFPA SGGLGTSIIN HLVKLVPASQ LILIARNPEK LASFSRDGAT IRRADYDDRA        60
     SLERVFDGVG VLMLISYASF EIQHRVEAHK AAIDAARRSG VKHIFYSSLA FAGDLGESSL       120
     AHVMGAHLAT EKYLAELPGH FTYTAIREGL YSESFPIYTA WFDPHQPVEE ITIPHPGTGP       180
     GVAWAKRDEL GEATAKMIYA YAKNTAGFPY LNRVVLLSGP REVSLAETAE VLGRAVGKPV       240
     RIREISVDEY VALPQIGDKH TYHGLNLSRE WATAWAAIRA GETAVVSPLL GEILGREPED       300
     FETTIRALVG AR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page