(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE234

ASFUM1_4.PE234       Location/Qualifiers
FT   CDS             999848..1000690
FT                   /codon_start=1
FT                   /gene_family="HOG000217284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259011"
FT                   /orf_name="AFUA_4G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84504.1"
FT                   /db_xref="HOGENOM:HBG054391"
FT                   /db_xref="UniParc:UPI000051FDA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V9"
FT                   /transl_table=1
FT                   /translation="MVVNADSISRHALGLSPTTSEYPYQGMKHFRDIVYKEAATTRNDY
FT                   VIFTNIDEHTFLRDFDESLRKSYSDFFPQARILVARMPATEVHEAAHTELHNTLMIMLG
FT                   AMNVHSQLLSLGVADVVTPTRTKEPDQSYKPMNFPAGYSSHWPSMVIETAFSESQSTPA
FT                   NDARWWLNASGGELKIVITIAVQKKREAITIDKWEATSRPTRGDPGKTVPEVVQKVTIT
FT                   REGGDAPVHVTGAPLIIGFEKLFLRPAEEEKGEGDVLFSHDDLAEIADKVWSVLNTGN"
     MVVNADSISR HALGLSPTTS EYPYQGMKHF RDIVYKEAAT TRNDYVIFTN IDEHTFLRDF        60
     DESLRKSYSD FFPQARILVA RMPATEVHEA AHTELHNTLM IMLGAMNVHS QLLSLGVADV       120
     VTPTRTKEPD QSYKPMNFPA GYSSHWPSMV IETAFSESQS TPANDARWWL NASGGELKIV       180
     ITIAVQKKRE AITIDKWEAT SRPTRGDPGK TVPEVVQKVT ITREGGDAPV HVTGAPLIIG       240
     FEKLFLRPAE EEKGEGDVLF SHDDLAEIAD KVWSVLNTGN                             280
//

If you have problems or comments...

PBIL Back to PBIL home page