(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE236

ASFUM1_4.PE236       Location/Qualifiers
FT   CDS             join(1004780..1004835,1004880..1005603)
FT                   /codon_start=1
FT                   /gene_family="HOG000171221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259013"
FT                   /orf_name="AFUA_4G03580"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /protein_id="EBA27183.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000F51A90"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA67"
FT                   /transl_table=1
FT                   /translation="MKLYLIRHAETVDNVAHRLAGVKDSPLTNHGALQIIRLGRYFASQ
FT                   NIKFSHIFSSDLSRAIRTAEGLSSHQPELSPVLLPSLRERDFGSFEGQKWHSTWESSIV
FT                   PKQPESEASMRQRANTFLTDYLVPLLLAGDEAGDEAGDEAVVAVVSHGLLLRSLWRALL
FT                   AYFHPSDVCIVGDADVNAFNPFWANTGYLELLVRPRLSPLVGVPEMPVLGGYSLQVLGV
FT                   NSRAHLADLRRTKGGVGSATFDQRQKRIDHFFGQKNR"
     MKLYLIRHAE TVDNVAHRLA GVKDSPLTNH GALQIIRLGR YFASQNIKFS HIFSSDLSRA        60
     IRTAEGLSSH QPELSPVLLP SLRERDFGSF EGQKWHSTWE SSIVPKQPES EASMRQRANT       120
     FLTDYLVPLL LAGDEAGDEA GDEAVVAVVS HGLLLRSLWR ALLAYFHPSD VCIVGDADVN       180
     AFNPFWANTG YLELLVRPRL SPLVGVPEMP VLGGYSLQVL GVNSRAHLAD LRRTKGGVGS       240
     ATFDQRQKRI DHFFGQKNR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page