(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE239

ASFUM1_4.PE239       Location/Qualifiers
FT   CDS             complement(1011241..1011687)
FT                   /codon_start=1
FT                   /gene_family="HOG000217751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259015"
FT                   /orf_name="AFUA_4G03595"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27185.1"
FT                   /db_xref="HOGENOM:HBG324425"
FT                   /db_xref="UniParc:UPI0000F51A91"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA71"
FT                   /transl_table=1
FT                   /translation="MTSMSTSTTTGTAAASTCTGNRWVLPVQDVACALPATGNYSSIMD
FT                   KCCSPAAVTKYNDGCGLYCLAQGQSMGDLLDCIKENGGNKDVFCGGQLNATATASLSET
FT                   ASSTATRTGTGASASETRDNGAPTKRVSVLGVGLVAMIVCGMFV"
     MTSMSTSTTT GTAAASTCTG NRWVLPVQDV ACALPATGNY SSIMDKCCSP AAVTKYNDGC        60
     GLYCLAQGQS MGDLLDCIKE NGGNKDVFCG GQLNATATAS LSETASSTAT RTGTGASASE       120
     TRDNGAPTKR VSVLGVGLVA MIVCGMFV                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page