(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE24

ASFUM1_4.PE24        Location/Qualifiers
FT   CDS             join(complement(94930..95754),complement(94739..94897))
FT                   /codon_start=1
FT                   /gene_family="HOG000200344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273685"
FT                   /orf_name="AFUA_4G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84383.1"
FT                   /db_xref="HOGENOM:HBG054281"
FT                   /db_xref="UniParc:UPI000051FC23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W958"
FT                   /transl_table=1
FT                   /translation="MLSEQTCSHSSIRSDSSPHAAKVGYEQRSLKQRTSAARLPGSPAP
FT                   SGSIDPTIFPAPLVLPGDDLALDPEYPPQSVLDWLDEEDRNEVTSDRKTVYVVAPPEYD
FT                   EDAYFAQAWTSPRVAKSQHHLIAPNPEDIVGYLAAFYHGMPVKLLRVSDFRFLPWDGQK
FT                   PTTSPRFIGLAVSDECIGIRTRACPDKLYPRQLNLDDLLDVAISILPQDAYALCLLVNH
FT                   DLYEDADDTFVCGRAYGGSRVAVVSSARYCPTLDEVQSVDREHSWPASHCDDYYQKAED
FT                   RQRIVILGYCTINRRGSRIVFPPKCRCITTVTIITLAFSTMPHCKP"
     MLSEQTCSHS SIRSDSSPHA AKVGYEQRSL KQRTSAARLP GSPAPSGSID PTIFPAPLVL        60
     PGDDLALDPE YPPQSVLDWL DEEDRNEVTS DRKTVYVVAP PEYDEDAYFA QAWTSPRVAK       120
     SQHHLIAPNP EDIVGYLAAF YHGMPVKLLR VSDFRFLPWD GQKPTTSPRF IGLAVSDECI       180
     GIRTRACPDK LYPRQLNLDD LLDVAISILP QDAYALCLLV NHDLYEDADD TFVCGRAYGG       240
     SRVAVVSSAR YCPTLDEVQS VDREHSWPAS HCDDYYQKAE DRQRIVILGY CTINRRGSRI       300
     VFPPKCRCIT TVTIITLAFS TMPHCKP                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page