(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE246

ASFUM1_4.PE246       Location/Qualifiers
FT   CDS             join(complement(1025250..1025362),
FT                   complement(1024970..1025205),complement(1024740..1024916),
FT                   complement(1024569..1024663))
FT                   /codon_start=1
FT                   /gene_family="HOG000201565" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901727"
FT                   /orf_name="AFUA_4G03645"
FT                   /product="Mitochondrial complex I protein Fmp36, putative "
FT                   /protein_id="EBA27188.1"
FT                   /db_xref="UniParc:UPI0000F51AA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA73"
FT                   /transl_table=1
FT                   /translation="MQGNFIFSAPTSRPRLDQWTSGSFGGHGSKIDVRKTRTSDAFYTG
FT                   TLEIERFLYHLKNEPENGTWYGVPYHLQKDNQYTWNTSQITLILDTMASQTAVTARSAY
FT                   RQILRATRIAFQDDFRVLVAARQEARRQFDEHRREGIDTPMQINHAKEVAAILRHNIVQ
FT                   GVRDSNDENGKWELRIHDDIERGDNDSIRVGGKKVKVDKPCSA"
     MQGNFIFSAP TSRPRLDQWT SGSFGGHGSK IDVRKTRTSD AFYTGTLEIE RFLYHLKNEP        60
     ENGTWYGVPY HLQKDNQYTW NTSQITLILD TMASQTAVTA RSAYRQILRA TRIAFQDDFR       120
     VLVAARQEAR RQFDEHRREG IDTPMQINHA KEVAAILRHN IVQGVRDSND ENGKWELRIH       180
     DDIERGDNDS IRVGGKKVKV DKPCSA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page