(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE247

ASFUM1_4.PE247       Location/Qualifiers
FT   CDS             join(1025465..1025614,1025679..1025819,1025873..1026922)
FT                   /codon_start=1
FT                   /gene_family="HOG000171054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206309"
FT                   /orf_name="AFUA_4G03650"
FT                   /product="Ribosome associated DnaJ chaperone Zuotin,
FT                   putative"
FT                   /function="heat shock protein binding"
FT                   /protein_id="EAL84514.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG383362"
FT                   /db_xref="HOGENOM:HBG525199"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000051E818"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U9"
FT                   /transl_table=1
FT                   /translation="MASQVINVTLPALPQGWSAEKDFTAVGTLSATTQRNLEPVGPHFL
FT                   AHARRKRHHRTFSEDERIQAQQNVKKTEDDDDDEISEPEDPVMLSRDAKDWKAQDHYAV
FT                   LGLSKYRWRATPEQIKRAHRKKVLRHHPDKKAALGDRDENDNFFKCIQKAHELLTDPVK
FT                   RRQFDSVDEAADVDPPSKKEVAKRGFYKAWGPVFEAEARFSKVQPVPQLGDENSTQEEV
FT                   ETFYNFWYNFDSWRSFEYLDEDVPDDNENRDQKRHIEKKNANARRKRKTEDIARLRHLV
FT                   DDCLAQDERIKKFRQQARAGKDKKRLEKEAEAKRLAEEKEKARLEEEQRKKEAEEAAKA
FT                   EREKNKKAKEAAKNAAKKNKRILKGSVKDVNYFAESGEPSPAQVDSVLTDVDSIIAKID
FT                   SEELAALAERLTTAGKDAAAVKGVWTEEVKRLVDAGKLKDGEAKFFA"
     MASQVINVTL PALPQGWSAE KDFTAVGTLS ATTQRNLEPV GPHFLAHARR KRHHRTFSED        60
     ERIQAQQNVK KTEDDDDDEI SEPEDPVMLS RDAKDWKAQD HYAVLGLSKY RWRATPEQIK       120
     RAHRKKVLRH HPDKKAALGD RDENDNFFKC IQKAHELLTD PVKRRQFDSV DEAADVDPPS       180
     KKEVAKRGFY KAWGPVFEAE ARFSKVQPVP QLGDENSTQE EVETFYNFWY NFDSWRSFEY       240
     LDEDVPDDNE NRDQKRHIEK KNANARRKRK TEDIARLRHL VDDCLAQDER IKKFRQQARA       300
     GKDKKRLEKE AEAKRLAEEK EKARLEEEQR KKEAEEAAKA EREKNKKAKE AAKNAAKKNK       360
     RILKGSVKDV NYFAESGEPS PAQVDSVLTD VDSIIAKIDS EELAALAERL TTAGKDAAAV       420
     KGVWTEEVKR LVDAGKLKDG EAKFFA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page