(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE25

ASFUM1_4.PE25        Location/Qualifiers
FT   CDS             join(96220..96643,96694..97313)
FT                   /codon_start=1
FT                   /gene_family="HOG000216783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210058"
FT                   /orf_name="AFUA_4G00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84382.1"
FT                   /db_xref="HOGENOM:HBG054270"
FT                   /db_xref="UniParc:UPI000051FC29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W959"
FT                   /transl_table=1
FT                   /translation="MVQQREEPPQQLSPRLQARLDEQFEIRDRFIRQEFARVHERIDDL
FT                   IKDNEARDKGIKREFRNVYERMDQMSQKMDQMSQKIDKLETSFTVFETTFANFKVAHLN
FT                   QRIQAIPVYDSFHQPVPVPKCFPKTALRLYRLQDRKNWNHLKTLLKHYNLERAAIQLVD
FT                   RGELYDSSDSDSDSDTSSRFHSIDRELDRAIESNPFAAMCSLGRHLGVDTDALHDRIMQ
FT                   LEFQQKKGTVAKRPAEDAGSVRKMIRELVTGALQPGSFTRAEPLLDDDSEGKYTKLEWE
FT                   VDSEKFKRETAHLRLRDTEVSPRPASAKDSPGNRQQRDLEVRSRQSKGSRSPTEKMTTS
FT                   SNQSQGH"
     MVQQREEPPQ QLSPRLQARL DEQFEIRDRF IRQEFARVHE RIDDLIKDNE ARDKGIKREF        60
     RNVYERMDQM SQKMDQMSQK IDKLETSFTV FETTFANFKV AHLNQRIQAI PVYDSFHQPV       120
     PVPKCFPKTA LRLYRLQDRK NWNHLKTLLK HYNLERAAIQ LVDRGELYDS SDSDSDSDTS       180
     SRFHSIDREL DRAIESNPFA AMCSLGRHLG VDTDALHDRI MQLEFQQKKG TVAKRPAEDA       240
     GSVRKMIREL VTGALQPGSF TRAEPLLDDD SEGKYTKLEW EVDSEKFKRE TAHLRLRDTE       300
     VSPRPASAKD SPGNRQQRDL EVRSRQSKGS RSPTEKMTTS SNQSQGH                     347
//

If you have problems or comments...

PBIL Back to PBIL home page