(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE251

ASFUM1_4.PE251       Location/Qualifiers
FT   CDS             join(complement(1034312..1034713),
FT                   complement(1033789..1034261),complement(1033295..1033715),
FT                   complement(1033107..1033220))
FT                   /codon_start=1
FT                   /gene_family="HOG000271513" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259022"
FT                   /orf_name="AFUA_4G03690"
FT                   /product="Aldehyde dehydrogenase family protein, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84518.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000F51A8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U5"
FT                   /transl_table=1
FT                   /translation="MANQIRTLSPSTNEVIFEHQGTSLEEARKIAQASYEAFKLYKKIT
FT                   LSERKDIIVKALELIAANIDTLSNELTTQMGRPIAYSAKEIETMRKRADYLLSIAEDSL
FT                   QEHPGQLEKGFRRSVKKEPVGPTLIATAWNYPYLITINTLVPALLAGNTVILRPSPQTP
FT                   LIGERLLSYFTQAGLPPNVLQLIHVGSLDVLDEIVKLPQIKLVSFTGSTAGGVRIREAT
FT                   ARRIVPVNLELGGKDPAYVRADADIPYVAAQIVDGAVFNSGQSCCSIERVYVHADVHDD
FT                   FVAEVQKELQTYKLGDPTDNSTTTGPVISRHAVKTIQSHIDDALSKGAINATPPNESFL
FT                   SVPSQKPQGNYIAPTVLTNVTHDMTVMKDETFGPVLPIMKVSSDEEAVALMNDSEYGLT
FT                   ASVWTRDIARGEELIAEIEAGTVFINRCDYPSPDLAWVGWKNSGLGCTLGPHAFDGFYK
FT                   LKSYHIKEEQA"
     MANQIRTLSP STNEVIFEHQ GTSLEEARKI AQASYEAFKL YKKITLSERK DIIVKALELI        60
     AANIDTLSNE LTTQMGRPIA YSAKEIETMR KRADYLLSIA EDSLQEHPGQ LEKGFRRSVK       120
     KEPVGPTLIA TAWNYPYLIT INTLVPALLA GNTVILRPSP QTPLIGERLL SYFTQAGLPP       180
     NVLQLIHVGS LDVLDEIVKL PQIKLVSFTG STAGGVRIRE ATARRIVPVN LELGGKDPAY       240
     VRADADIPYV AAQIVDGAVF NSGQSCCSIE RVYVHADVHD DFVAEVQKEL QTYKLGDPTD       300
     NSTTTGPVIS RHAVKTIQSH IDDALSKGAI NATPPNESFL SVPSQKPQGN YIAPTVLTNV       360
     THDMTVMKDE TFGPVLPIMK VSSDEEAVAL MNDSEYGLTA SVWTRDIARG EELIAEIEAG       420
     TVFINRCDYP SPDLAWVGWK NSGLGCTLGP HAFDGFYKLK SYHIKEEQA                   469
//

If you have problems or comments...

PBIL Back to PBIL home page