(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE254

ASFUM1_4.PE254       Location/Qualifiers
FT   CDS             join(1038284..1038454,1038513..1038629,1038697..1039183,
FT                   1039269..1039678)
FT                   /codon_start=1
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259023"
FT                   /orf_name="AFUA_4G03722"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27190.1"
FT                   /db_xref="HOGENOM:HBG324429"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI0000F51A6F"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA75"
FT                   /transl_table=1
FT                   /translation="MDFSLQNHRSFIGRPATDLPTPAVVLSKPILERNIKQLLQDVKDL
FT                   EISFRPHVKTLKSIEVTRMMLGNGTHRRIVASTLCEIRGALPLAEEGILDEALYGIPIY
FT                   PSALPQLAALSSKLKIVLMVDNEAQIDALESFAQSTGRTAPWPVFIKVDVGSHRAGLES
FT                   SSSAMRLLVEKVESSHAAEVYGFYCHAGHSYACRTEEAAAAVLKSELEGVVRAAGYLDR
FT                   KEGRKVVVSFGSTPTAHVVNSLRRALPEGMDVELHAGNFPANDLQQVCTGLVAEEQQAV
FT                   RVLVEVCSVYPERNEALINAGTVALTKETSDVVGFGRVTDRPGWAVVRMAQEHGILGLA
FT                   NASGVQRVEETFRVGQKVMLYIQHACITAAQHHVYHVVDEEDIVRETWVPWKGW"
     MDFSLQNHRS FIGRPATDLP TPAVVLSKPI LERNIKQLLQ DVKDLEISFR PHVKTLKSIE        60
     VTRMMLGNGT HRRIVASTLC EIRGALPLAE EGILDEALYG IPIYPSALPQ LAALSSKLKI       120
     VLMVDNEAQI DALESFAQST GRTAPWPVFI KVDVGSHRAG LESSSSAMRL LVEKVESSHA       180
     AEVYGFYCHA GHSYACRTEE AAAAVLKSEL EGVVRAAGYL DRKEGRKVVV SFGSTPTAHV       240
     VNSLRRALPE GMDVELHAGN FPANDLQQVC TGLVAEEQQA VRVLVEVCSV YPERNEALIN       300
     AGTVALTKET SDVVGFGRVT DRPGWAVVRM AQEHGILGLA NASGVQRVEE TFRVGQKVML       360
     YIQHACITAA QHHVYHVVDE EDIVRETWVP WKGW                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page