(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE259

ASFUM1_4.PE259       Location/Qualifiers
FT   CDS             join(1055168..1055462,1055509..1056845)
FT                   /codon_start=1
FT                   /gene_family="HOG000257692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206312"
FT                   /orf_name="AFUA_4G03770"
FT                   /product="Chlorohydrolase family protein "
FT                   /EC_number="3.5.4.3"
FT                   /function="guanine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84526.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008892"
FT                   /db_xref="HOGENOM:HBG004678"
FT                   /db_xref="HOGENOM:HBG417542"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniParc:UPI000051E819"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T7"
FT                   /transl_table=1
FT                   /translation="MATATAPTYTLFLGTFIHLPRKPTGADPGAKWRPALEINHGALWV
FT                   SNSDGKIAGFDWSFSPADGDVNSLTEKLGLSGKVTEVVRAREERNEFFFPGFIADRQDT
FT                   HIHAPQYPNSGIFGSSTLLDWLETYTFPLESSFGDASKARAVYSRVIARTLANGTTCAS
FT                   YFATIHVPATNLLASLCHSRGQRALIGRVCMDNPSFCPDYYLDSSPESSVSKSKETIAH
FT                   IHSIDPAGTLIHPILTPRFAPTCSPPALHGLAQLAQSYNPPLHIQTHLSENTGEISLVR
FT                   ELFPQSKDYTSVYDDFGLLTPRTILAHAVHLSPSERELIAARGAKVSHCPASNSALGSG
FT                   LCAVRKLLEAGVEVGLGTDVSGGYNCSVLEAVRQGCLVSRLLRHSGTDDPGDGDDGEEV
FT                   LSVEEGLYLATRGGAAVVDLAGEIGGFEVGMSFDAQMVRLGHSHTSSSPTAEHGVVDVF
FT                   GWESWTEKVHKWVWTGDDRNVKAVWVRGRLVHSLDEGQSQSDVSIPEKGKPTWIWAGTG
FT                   AAWESKWWLCGLGFVSAWFIFDRVMR"
     MATATAPTYT LFLGTFIHLP RKPTGADPGA KWRPALEINH GALWVSNSDG KIAGFDWSFS        60
     PADGDVNSLT EKLGLSGKVT EVVRAREERN EFFFPGFIAD RQDTHIHAPQ YPNSGIFGSS       120
     TLLDWLETYT FPLESSFGDA SKARAVYSRV IARTLANGTT CASYFATIHV PATNLLASLC       180
     HSRGQRALIG RVCMDNPSFC PDYYLDSSPE SSVSKSKETI AHIHSIDPAG TLIHPILTPR       240
     FAPTCSPPAL HGLAQLAQSY NPPLHIQTHL SENTGEISLV RELFPQSKDY TSVYDDFGLL       300
     TPRTILAHAV HLSPSERELI AARGAKVSHC PASNSALGSG LCAVRKLLEA GVEVGLGTDV       360
     SGGYNCSVLE AVRQGCLVSR LLRHSGTDDP GDGDDGEEVL SVEEGLYLAT RGGAAVVDLA       420
     GEIGGFEVGM SFDAQMVRLG HSHTSSSPTA EHGVVDVFGW ESWTEKVHKW VWTGDDRNVK       480
     AVWVRGRLVH SLDEGQSQSD VSIPEKGKPT WIWAGTGAAW ESKWWLCGLG FVSAWFIFDR       540
     VMR                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page