(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE264

ASFUM1_4.PE264       Location/Qualifiers
FT   CDS             join(complement(1069401..1069524),
FT                   complement(1068722..1069351),complement(1068531..1068667))
FT                   /codon_start=1
FT                   /gene_family="HOG000170964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259027"
FT                   /orf_name="AFUA_4G03820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84531.1"
FT                   /db_xref="HOGENOM:HBG054408"
FT                   /db_xref="HOGENOM:HBG327366"
FT                   /db_xref="UniParc:UPI000051EC81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T2"
FT                   /transl_table=1
FT                   /translation="MRSLNFLSLLSLLLLLGTISSAWPWPQDGLNMAHGEIVARADTTA
FT                   SDETKTDSKASKTDSASDTNTADSTATDSSSGKKTSTGTAKETGTQTESGTSTETATDK
FT                   SGKNSKTKTSTKSTSIDPRLPAGGTSMLIPTAGATTYYKIGDYVTFAWNYTSLLVTPSA
FT                   VNVLATCTMNSATYTLTSNMSVEETGKVVWDTGKYQANATVPLLTATYTLYVVDVDKDI
FT                   GDTASPGHLGSQNGYLFGMYSPQPYTPLNEFNCATCNSALSDVERQALKFALGMVMITI
FT                   ASFTWFAGDFGVFST"
     MRSLNFLSLL SLLLLLGTIS SAWPWPQDGL NMAHGEIVAR ADTTASDETK TDSKASKTDS        60
     ASDTNTADST ATDSSSGKKT STGTAKETGT QTESGTSTET ATDKSGKNSK TKTSTKSTSI       120
     DPRLPAGGTS MLIPTAGATT YYKIGDYVTF AWNYTSLLVT PSAVNVLATC TMNSATYTLT       180
     SNMSVEETGK VVWDTGKYQA NATVPLLTAT YTLYVVDVDK DIGDTASPGH LGSQNGYLFG       240
     MYSPQPYTPL NEFNCATCNS ALSDVERQAL KFALGMVMIT IASFTWFAGD FGVFST           296
//

If you have problems or comments...

PBIL Back to PBIL home page