(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE265

ASFUM1_4.PE265       Location/Qualifiers
FT   CDS             join(complement(1070872..1071178),
FT                   complement(1070686..1070813))
FT                   /codon_start=1
FT                   /gene_family="HOG000170953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259028"
FT                   /orf_name="AFUA_4G03830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84532.1"
FT                   /db_xref="HOGENOM:HBG054409"
FT                   /db_xref="HOGENOM:HBG327365"
FT                   /db_xref="UniParc:UPI00005201FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T1"
FT                   /transl_table=1
FT                   /translation="MRLLSTLTLLVSAVAANPMFHTARQDTSATKPFHLKTADASNEKH
FT                   NDLYVYAYHTGAGFNDAVLTPDKDTASTAFLNGTYTQFDLKTPFPWGFKPIAVTNYAQW
FT                   ESVEINVGYGAEGFFIDSTGLQWSEQQGFGGWLGKQFPCR"
     MRLLSTLTLL VSAVAANPMF HTARQDTSAT KPFHLKTADA SNEKHNDLYV YAYHTGAGFN        60
     DAVLTPDKDT ASTAFLNGTY TQFDLKTPFP WGFKPIAVTN YAQWESVEIN VGYGAEGFFI       120
     DSTGLQWSEQ QGFGGWLGKQ FPCR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page