(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE266

ASFUM1_4.PE266       Location/Qualifiers
FT   CDS             join(complement(1076026..1076256),
FT                   complement(1075900..1075973),complement(1072502..1075841))
FT                   /codon_start=1
FT                   /gene_family="HOG000170952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259029"
FT                   /orf_name="AFUA_4G03840"
FT                   /product="DNA repair protein Rhp26/Rad26, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="EAL84533.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054410"
FT                   /db_xref="HOGENOM:HBG590781"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051EC70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T0"
FT                   /transl_table=1
FT                   /translation="MDHSVKNEGDSSAEIEVVETPQRTEGLDPSDTAEVATAPDSKQQE
FT                   DPSAVTDEVTRLRELQADIRDQDDLERDISRQADRLLMEQADERDKRRLEKTTLEKEKL
FT                   EAQILKVHQRLSQPVGTSARVRLENELNNLESRNASLENDLKEIQKRIDDRHEGLEAGT
FT                   QATGTGRMPNESRRDYLIRTGKITPFSRMGTGPNEGPLASLHDALIDAEDERDEDEALE
FT                   QLKDRSAVSHRNLVRPGFDFDHESTDTSIAQTRPSKRRKLEGDARRKKAAIKQEDSDSI
FT                   AADEGIEISEDNDESADYVASEDQESLLGDEEEFFPDGKPERPLAHKKGKKPGDEMEDF
FT                   SGLDDGDERLYQSRLQSWVSRRSAARKRASKALQATEGHESTIDEQASTEEDEWFLPHP
FT                   TVPDVSYDNGYRLPGDLNPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQAIAF
FT                   LAGLHYSKKLDRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRSESSRE
FT                   DALLSQTYSSNSRGITSNQKAARKVVKRVVEEGHVLVTTYSGLQTYSHFLIPVEWGCAI
FT                   LDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNF
FT                   RNQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVL
FT                   FCKLTKPQRMAYESFLKSEEMESILKGRRQILYGVDILRKICNHPDLQNHKMQSHQSGY
FT                   GNANKSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVRSLSGFNYRRMDGTTP
FT                   IQNRQTMVDEFNNDPNIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAW
FT                   RLGQKRDVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTSFQLSDLYDLFAL
FT                   GDEKPGATETSKLFQDAQVTFHGDGDGNTAQPTKAEDVSSDMQAEKNDISKVVGVSSVE
FT                   RYQGESEQPSDQEKGPGGVNSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIE
FT                   AEAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGVAGRPEERPLPSAFGGRSSTARR
FT                   TAAGPSSASILANLSARTPSSRSATNSPAPSRSPTGVDFMTMIRDYILSQGGAVYTQML
FT                   IDHFNRYCTTPQRSAEFKEMLKTIAVLEKGGRNGRGRWSLKPEFAKVK"
     MDHSVKNEGD SSAEIEVVET PQRTEGLDPS DTAEVATAPD SKQQEDPSAV TDEVTRLREL        60
     QADIRDQDDL ERDISRQADR LLMEQADERD KRRLEKTTLE KEKLEAQILK VHQRLSQPVG       120
     TSARVRLENE LNNLESRNAS LENDLKEIQK RIDDRHEGLE AGTQATGTGR MPNESRRDYL       180
     IRTGKITPFS RMGTGPNEGP LASLHDALID AEDERDEDEA LEQLKDRSAV SHRNLVRPGF       240
     DFDHESTDTS IAQTRPSKRR KLEGDARRKK AAIKQEDSDS IAADEGIEIS EDNDESADYV       300
     ASEDQESLLG DEEEFFPDGK PERPLAHKKG KKPGDEMEDF SGLDDGDERL YQSRLQSWVS       360
     RRSAARKRAS KALQATEGHE STIDEQASTE EDEWFLPHPT VPDVSYDNGY RLPGDLNPYL       420
     FDYQKTGVQW LWELYQQKVG GIIGDEMGLG KTIQAIAFLA GLHYSKKLDR PVIVVCPATV       480
     MKQWVNEFHR WWPPFRVSIL HTSGSGMVNI RSESSREDAL LSQTYSSNSR GITSNQKAAR       540
     KVVKRVVEEG HVLVTTYSGL QTYSHFLIPV EWGCAILDEG HKIRNPNTSI TIHCKELRTP       600
     HRIILSGTPM QNNLTELWSL FDFVFPMRLG TLVNFRNQFE FPIRQGGYAN ASNLQVQTAA       660
     KCAETLKDAI SPYLLQRFKI DVAADLPKKT EQVLFCKLTK PQRMAYESFL KSEEMESILK       720
     GRRQILYGVD ILRKICNHPD LQNHKMQSHQ SGYGNANKSG KMQVVKSLLE LWRDTGHKTL       780
     LFAQHRIMLD ILEKFVRSLS GFNYRRMDGT TPIQNRQTMV DEFNNDPNIH VFLLTTKVGG       840
     LGVNLTGADR VIIYDPDWNP STDVQARERA WRLGQKRDVS VYRLMTAGTI EEKIYHRQIF       900
     KQFLTNKILR DPKQRQTSFQ LSDLYDLFAL GDEKPGATET SKLFQDAQVT FHGDGDGNTA       960
     QPTKAEDVSS DMQAEKNDIS KVVGVSSVER YQGESEQPSD QEKGPGGVNS ESRIMEGIFA      1020
     RSGVHSALEH DQIVNGKRVV RADPKIIEAE AKRVAAEAAE ELRRAGEAAR SVPIGTPTWT      1080
     GQFGVAGRPE ERPLPSAFGG RSSTARRTAA GPSSASILAN LSARTPSSRS ATNSPAPSRS      1140
     PTGVDFMTMI RDYILSQGGA VYTQMLIDHF NRYCTTPQRS AEFKEMLKTI AVLEKGGRNG      1200
     RGRWSLKPEF AKVK                                                        1214
//

If you have problems or comments...

PBIL Back to PBIL home page