(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE277

ASFUM1_4.PE277       Location/Qualifiers
FT   CDS             join(complement(1105824..1106041),
FT                   complement(1104973..1105750))
FT                   /codon_start=1
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206316"
FT                   /orf_name="AFUA_4G03945"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27191.1"
FT                   /db_xref="HOGENOM:HBG332679"
FT                   /db_xref="UniParc:UPI0000F51AA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA76"
FT                   /transl_table=1
FT                   /translation="MSRNALTPDGPVTIPAPAAERALKPPTAPTASASATASSRWNTDK
FT                   LGMRLGVDIASAMTAGALTCPVITVIDRAIIEKAAKGLPIRSTLTACFRSMLTRPAAFV
FT                   TSVPFLLIYTLYTSTYLTANAIDTLASTLRDRPFETVFPGTAKFLTTTAVNMGICVYKD
FT                   ARFARIFGAGNNAAASTTTGSRTGGGAPGGATCHPSGTSALKVPKISYALFCLRDSITI
FT                   FASFNVPALLAPRIPDGIVATAGGKSALAQFACPALMQFVSTPMHLLGLDLYNRQPVGG
FT                   LGWRERVGRIRRDYVASCFARMGKIVPAYGVGGVVNVRMREGLMRRLSAS"
     MSRNALTPDG PVTIPAPAAE RALKPPTAPT ASASATASSR WNTDKLGMRL GVDIASAMTA        60
     GALTCPVITV IDRAIIEKAA KGLPIRSTLT ACFRSMLTRP AAFVTSVPFL LIYTLYTSTY       120
     LTANAIDTLA STLRDRPFET VFPGTAKFLT TTAVNMGICV YKDARFARIF GAGNNAAAST       180
     TTGSRTGGGA PGGATCHPSG TSALKVPKIS YALFCLRDSI TIFASFNVPA LLAPRIPDGI       240
     VATAGGKSAL AQFACPALMQ FVSTPMHLLG LDLYNRQPVG GLGWRERVGR IRRDYVASCF       300
     ARMGKIVPAY GVGGVVNVRM REGLMRRLSA S                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page