(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE281

ASFUM1_4.PE281       Location/Qualifiers
FT   CDS             join(complement(1119504..1120443),
FT                   complement(1119026..1119454),complement(1118749..1118969))
FT                   /codon_start=1
FT                   /gene_family="HOG000170796" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259036"
FT                   /orf_name="AFUA_4G03980"
FT                   /product="Chromosome segregation protein (Pcs1), putative "
FT                   /function="DNA binding"
FT                   /protein_id="EAL84547.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG054419"
FT                   /db_xref="HOGENOM:HBG327807"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniParc:UPI000051FFAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R6"
FT                   /transl_table=1
FT                   /translation="MPKRKATGRLSGQAGSDGANAMQVNGNDAGQRENERPAKRARGRP
FT                   RSKSVESKPPAETKRNSTVAQAQAPDSGPKKASKRGRPKGSRNSAHGATQEGPERKGGN
FT                   EKIKDEVGVQESESLAASDDELDDAPVATKTNQKAKSAKPAATRGRKKVSAGKQVQTDG
FT                   EFEYTPRATRHVQPPAESQDQLEQPMSQSRHIHWTDPSSVAAENEQEEMELVEDTNLHE
FT                   EAVVPRSTSASPMKGRRPSQPAPGSSPLKKKLGVSTDDDRTGEPELRRRLGDLTKKYDT
FT                   LENRYRNLREIGIVEANANMEKLRQHCEAVTTASNNLVASLKAELEAQKKLGQQSRALQ
FT                   KQLKERDAEVAELKSQVSEAKKQLTSAQSEVKALQTKLAAARNTTASLENAAAKVPGSA
FT                   IKNNRANRAADAEAAQAAHLSQLKEELYSDLTGLVILDVKKRESDHLYDCLQTGVNGTL
FT                   HFKLAVPTITSTNFETAEFQYIPLLDESRDRELVEILPEYLTVDITFVRQQASKFYTRV
FT                   IDALTKRRSSTN"
     MPKRKATGRL SGQAGSDGAN AMQVNGNDAG QRENERPAKR ARGRPRSKSV ESKPPAETKR        60
     NSTVAQAQAP DSGPKKASKR GRPKGSRNSA HGATQEGPER KGGNEKIKDE VGVQESESLA       120
     ASDDELDDAP VATKTNQKAK SAKPAATRGR KKVSAGKQVQ TDGEFEYTPR ATRHVQPPAE       180
     SQDQLEQPMS QSRHIHWTDP SSVAAENEQE EMELVEDTNL HEEAVVPRST SASPMKGRRP       240
     SQPAPGSSPL KKKLGVSTDD DRTGEPELRR RLGDLTKKYD TLENRYRNLR EIGIVEANAN       300
     MEKLRQHCEA VTTASNNLVA SLKAELEAQK KLGQQSRALQ KQLKERDAEV AELKSQVSEA       360
     KKQLTSAQSE VKALQTKLAA ARNTTASLEN AAAKVPGSAI KNNRANRAAD AEAAQAAHLS       420
     QLKEELYSDL TGLVILDVKK RESDHLYDCL QTGVNGTLHF KLAVPTITST NFETAEFQYI       480
     PLLDESRDRE LVEILPEYLT VDITFVRQQA SKFYTRVIDA LTKRRSSTN                   529
//

If you have problems or comments...

PBIL Back to PBIL home page