(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE285

ASFUM1_4.PE285       Location/Qualifiers
FT   CDS             join(complement(1129179..1129309),
FT                   complement(1129048..1129112),complement(1128904..1128964),
FT                   complement(1128812..1128832),complement(1128714..1128755),
FT                   complement(1128601..1128643))
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259037"
FT                   /gene_name="fpr1B"
FT                   /orf_name="AFUA_4G04020"
FT                   /product="FK506-binding protein 1B "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL84551.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI0000520413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9R2"
FT                   /transl_table=1
FT                   /translation="MGLEKQTLRMGNGKDHPQPGDPVELNYTGYLYDESNPDHHKGKEF
FT                   DSSKRRGPLKATIGAGDVIRGWDEGVRQMSLGEKAILTMSGEYAYGEKGFPGLIPPNAS
FT                   LVFEVELLKIKDHGLD"
     MGLEKQTLRM GNGKDHPQPG DPVELNYTGY LYDESNPDHH KGKEFDSSKR RGPLKATIGA        60
     GDVIRGWDEG VRQMSLGEKA ILTMSGEYAY GEKGFPGLIP PNASLVFEVE LLKIKDHGLD       120
//

If you have problems or comments...

PBIL Back to PBIL home page