(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE287

ASFUM1_4.PE287       Location/Qualifiers
FT   CDS             complement(1131962..1132423)
FT                   /codon_start=1
FT                   /gene_family="HOG000014315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055114"
FT                   /gene_name="pptB"
FT                   /orf_name="AFUA_4G04040"
FT                   /product="Mitochondrial phosphopantetheinyl transferase B "
FT                   /EC_number="2.7.8.-"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84553.1"
FT                   /db_xref="EMBL:AAY99390.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG054421"
FT                   /db_xref="HOGENOM:HBG327804"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI000051E59F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R0"
FT                   /transl_table=1
FT                   /translation="MKLIPFPYPLNIGTDVVHLPRILRLINRPDYFHRFTRRILHEQEQ
FT                   RDFRTRFSLPPPSSGAEKTGLNPITPDMARWLAGRFAAKEAARKAAPAGASSLGWKDVI
FT                   VRVGEADKGRPEIVYLDPMGCGETGGGRVGKLSISHDGDYVVATVLAAG"
     MKLIPFPYPL NIGTDVVHLP RILRLINRPD YFHRFTRRIL HEQEQRDFRT RFSLPPPSSG        60
     AEKTGLNPIT PDMARWLAGR FAAKEAARKA APAGASSLGW KDVIVRVGEA DKGRPEIVYL       120
     DPMGCGETGG GRVGKLSISH DGDYVVATVL AAG                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page