(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE290

ASFUM1_4.PE290       Location/Qualifiers
FT   CDS             join(1144928..1145186,1145249..1145775,1145847..1146626)
FT                   /codon_start=1
FT                   /gene_family="HOG000170730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055115"
FT                   /orf_name="AFUA_4G04080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84556.1"
FT                   /db_xref="HOGENOM:HBG054424"
FT                   /db_xref="UniParc:UPI000051F18C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q7"
FT                   /transl_table=1
FT                   /translation="MARYSSRLETIPESPELPNPALQMTENWRPIPDLEPDRKKMRGPG
FT                   PVPESKSPVEVCVHGLTAKFFLDLPDDRIIPSYYLKKAERTVIVHRTPWCFRNADDARD
FT                   VDINKWSPVDIRFRSVFMTLRKLPEFGSLYDEDEDEDEGYGTTDAGGSKPKPKFDEMVK
FT                   LQGQVVYALLQGILEAFKVTRETDDSDSYLFFRSVASPWHVIPGACTHSGHRARLLNCQ
FT                   LEYWIGYSERYKDGPLTAGLACLDHHPDKRACPTVLPVSASLENTFLRSALEDKLKLML
FT                   GQLLLNISRLRPHGDQIPDQEVYLIGIYGSRLHILRAIFLGQKTSHLWSGRHNRSSSDA
FT                   DVIDPNPSTVYDRFYTGKNLERLRQQVEWLSVKNLDNNPNPRHFRVLGSREFDLWCKQD
FT                   FRAAVKMIVALFIYMMSGQARCGVLQKVFQNYPIDEESDDELEEVHDTRKRVAIEEEKL
FT                   AKKEKELEETERKKREEEQKMSKSKGKRRSYIHGRFQGFKGWRKPCEDFAWQKETDSSL
FT                   DDDL"
     MARYSSRLET IPESPELPNP ALQMTENWRP IPDLEPDRKK MRGPGPVPES KSPVEVCVHG        60
     LTAKFFLDLP DDRIIPSYYL KKAERTVIVH RTPWCFRNAD DARDVDINKW SPVDIRFRSV       120
     FMTLRKLPEF GSLYDEDEDE DEGYGTTDAG GSKPKPKFDE MVKLQGQVVY ALLQGILEAF       180
     KVTRETDDSD SYLFFRSVAS PWHVIPGACT HSGHRARLLN CQLEYWIGYS ERYKDGPLTA       240
     GLACLDHHPD KRACPTVLPV SASLENTFLR SALEDKLKLM LGQLLLNISR LRPHGDQIPD       300
     QEVYLIGIYG SRLHILRAIF LGQKTSHLWS GRHNRSSSDA DVIDPNPSTV YDRFYTGKNL       360
     ERLRQQVEWL SVKNLDNNPN PRHFRVLGSR EFDLWCKQDF RAAVKMIVAL FIYMMSGQAR       420
     CGVLQKVFQN YPIDEESDDE LEEVHDTRKR VAIEEEKLAK KEKELEETER KKREEEQKMS       480
     KSKGKRRSYI HGRFQGFKGW RKPCEDFAWQ KETDSSLDDD L                           521
//

If you have problems or comments...

PBIL Back to PBIL home page