(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE291

ASFUM1_4.PE291       Location/Qualifiers
FT   CDS             complement(1146874..1149135)
FT                   /codon_start=1
FT                   /gene_family="HOG000170719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259040"
FT                   /orf_name="AFUA_4G04090"
FT                   /product="Conserved serine-threonine rich protein "
FT                   /protein_id="EAL84557.1"
FT                   /db_xref="HOGENOM:HBG054427"
FT                   /db_xref="HOGENOM:HBG327798"
FT                   /db_xref="UniParc:UPI000051FFAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q6"
FT                   /transl_table=1
FT                   /translation="MAYTLVLSNPKHLRCSRAILRYSQVPYVTYLKVPSTTSVQSRGIW
FT                   RLTYHRYGSRSSDERRRLEKYLRHGPSKLRDRQVGHRQRSQSSFDDHHSWWNSGWGWSQ
FT                   LRFHGPTNWNEHAPRNDYWEAQRIRLEKRMEQIKKEIEADPYEALFGRRLDPFKSWGKH
FT                   ENIFSSLFRSLFGQGSKAEAEPKVTDTTARVKTDAAHPSDPRPSGKQSASPRSEVNAYK
FT                   EPTEDDTGDYEFDPITGRMVPKKGETFERSQDSPYTETPNSSICSNTVQSESARSAGFL
FT                   SPLDRSEPHPNTKGVTEAGAHDNTVQSETVDGPSPQSTTQDPNEFAYGGSILTAKPGIS
FT                   DENILKEPTEPRDTNTTFTKGVPSSEIEMANEQLSIDNPRLKADNVPPSAISHQNEGSS
FT                   GVPTETKDPLATAQRTSHGLKLQEEWVTQAERAEDLDILRASDIRTPYELKNKDGDPEE
FT                   QLRDKRRKLDLAFEMTEDPVKDIDVRRIREKYKIHEASKSKETVLEPLDSRKAQLPSQS
FT                   SMIASTFLPHSQGDIRNVRLDPNHEAQGARNEVQVSPNDSWATATYRVLVYDPSTSQVV
FT                   EAETSSSLQSTDKLLSPAEVLPRLSQPAKFVPYLAEMRDDGYEIVSGGEDIIVFRKASG
FT                   SGSALRSKTPSNGGSAGRLTSPQLDPGENIRAATAPSDSSSNPGIVSTADGSKVTGHAN
FT                   AWSRVQTALRRMLIGGVATAGTCYAIGVVVEYFRTGGEEGLGIDAFTEFESERRRRDRE
FT                   "
     MAYTLVLSNP KHLRCSRAIL RYSQVPYVTY LKVPSTTSVQ SRGIWRLTYH RYGSRSSDER        60
     RRLEKYLRHG PSKLRDRQVG HRQRSQSSFD DHHSWWNSGW GWSQLRFHGP TNWNEHAPRN       120
     DYWEAQRIRL EKRMEQIKKE IEADPYEALF GRRLDPFKSW GKHENIFSSL FRSLFGQGSK       180
     AEAEPKVTDT TARVKTDAAH PSDPRPSGKQ SASPRSEVNA YKEPTEDDTG DYEFDPITGR       240
     MVPKKGETFE RSQDSPYTET PNSSICSNTV QSESARSAGF LSPLDRSEPH PNTKGVTEAG       300
     AHDNTVQSET VDGPSPQSTT QDPNEFAYGG SILTAKPGIS DENILKEPTE PRDTNTTFTK       360
     GVPSSEIEMA NEQLSIDNPR LKADNVPPSA ISHQNEGSSG VPTETKDPLA TAQRTSHGLK       420
     LQEEWVTQAE RAEDLDILRA SDIRTPYELK NKDGDPEEQL RDKRRKLDLA FEMTEDPVKD       480
     IDVRRIREKY KIHEASKSKE TVLEPLDSRK AQLPSQSSMI ASTFLPHSQG DIRNVRLDPN       540
     HEAQGARNEV QVSPNDSWAT ATYRVLVYDP STSQVVEAET SSSLQSTDKL LSPAEVLPRL       600
     SQPAKFVPYL AEMRDDGYEI VSGGEDIIVF RKASGSGSAL RSKTPSNGGS AGRLTSPQLD       660
     PGENIRAATA PSDSSSNPGI VSTADGSKVT GHANAWSRVQ TALRRMLIGG VATAGTCYAI       720
     GVVVEYFRTG GEEGLGIDAF TEFESERRRR DRE                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page