(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE293

ASFUM1_4.PE293       Location/Qualifiers
FT   CDS             join(1152248..1153626,1153685..1153901)
FT                   /codon_start=1
FT                   /gene_family="HOG000170697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206317"
FT                   /orf_name="AFUA_4G04110"
FT                   /product="SAC3/GANP domain protein "
FT                   /protein_id="EAL84559.1"
FT                   /db_xref="HOGENOM:HBG243792"
FT                   /db_xref="HOGENOM:HBG735264"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI000051F3EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q4"
FT                   /transl_table=1
FT                   /translation="MSSGIPPWRTTASATATTAHFPAHGMCFLTLISLYSISNCDLATP
FT                   AYIPVQARRSFAHTSTTAMVPQPQPTTTQAPRKRVEWPAPLRSYVQRSFAPENQLPGVN
FT                   RQEMEVKLKGVITEAAEKGQLEKINWDALPLPQVMIQNERNQILTNPAVSGWSDSLLTA
FT                   AQKPDTVTEDVSRKRKSAEYGDKDSCPPWRQTNNHHAFGDRTTYPSADKRQRVDHKNPS
FT                   KSKANLEMRRKRFEEPRARYGSSPSSSRGESPAPSANQGPVVGRCQELEKNYFRLTSAP
FT                   NPDTVRPLHVLHKTLDLLKKKWKKDNNYGYICDQFKSLRQDLTVQHIRNEFTVSVYEIH
FT                   ARIALEKGDLGEYNQCQTQLRALYAQNLGGHPTEFKAYRILYFIHTRNWTAMNDALADL
FT                   TAADKRDPAVKHALDVRSALALGNYHRFFQLYLDTPNMGAYLMDMFVDRERLSALAAIC
FT                   KAYKPDVKIRFITEELGFESDEQSARFILDHASEDLLQEKDGSVRLFTSGRAAQLFEAA
FT                   KSEAHRVVDIKGQI"
     MSSGIPPWRT TASATATTAH FPAHGMCFLT LISLYSISNC DLATPAYIPV QARRSFAHTS        60
     TTAMVPQPQP TTTQAPRKRV EWPAPLRSYV QRSFAPENQL PGVNRQEMEV KLKGVITEAA       120
     EKGQLEKINW DALPLPQVMI QNERNQILTN PAVSGWSDSL LTAAQKPDTV TEDVSRKRKS       180
     AEYGDKDSCP PWRQTNNHHA FGDRTTYPSA DKRQRVDHKN PSKSKANLEM RRKRFEEPRA       240
     RYGSSPSSSR GESPAPSANQ GPVVGRCQEL EKNYFRLTSA PNPDTVRPLH VLHKTLDLLK       300
     KKWKKDNNYG YICDQFKSLR QDLTVQHIRN EFTVSVYEIH ARIALEKGDL GEYNQCQTQL       360
     RALYAQNLGG HPTEFKAYRI LYFIHTRNWT AMNDALADLT AADKRDPAVK HALDVRSALA       420
     LGNYHRFFQL YLDTPNMGAY LMDMFVDRER LSALAAICKA YKPDVKIRFI TEELGFESDE       480
     QSARFILDHA SEDLLQEKDG SVRLFTSGRA AQLFEAAKSE AHRVVDIKGQ I                531
//

If you have problems or comments...

PBIL Back to PBIL home page