(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE294

ASFUM1_4.PE294       Location/Qualifiers
FT   CDS             join(1157175..1157180,1157480..1157581,1157782..1158549,
FT                   1158614..1159534)
FT                   /codon_start=1
FT                   /gene_family="HOG000170685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259041"
FT                   /orf_name="AFUA_4G04120"
FT                   /product="Protein kinase activator Bem1, putative "
FT                   /function="kinase activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="EAL84560.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000F51A8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q3"
FT                   /transl_table=1
FT                   /translation="MKAIRRSLKGEKDPKPHHHHLSITPKSAIAILPPKKVIKALYDYQ
FT                   PEPGNTQELAFSKGDFFHVISREDDLDWYEACNPLIPSARGLVPVSFFEVIGKNERDSG
FT                   GSVDLHKKKESHDSGFSDRGPAQFSSPDHTPTQLQHSPSTPRMSTLGKASSAMVYGIVQ
FT                   YDFQAERPDELDAKAGEAIIVIAQSNPEWFVAKPIGRLGGPGLIPVSFIELRDMQTGQA
FT                   VSDPLEAVKRAGVPRVEEWKKMTAEYKNSSITLGKIDSAASAVQSVTSGVEKMSMGRNS
FT                   AGHAGQNGNAYGYHNRNASKASLPQHLSQPPMPNHHQQPLVAPVAASIPRYCFDNDKYW
FT                   YIIEAKMEDGRCWELSRYYHDFYDFQIALLTQFEEEAGNRGKPRTLPFMPGPVTHVTDA
FT                   ISNGRRQNLDEYIKKLLAMPPHISRCQLVRQLFAPRPGDFEIDPSAFGEDARYSGGSHH
FT                   SSTQETSRTASRQSSQAQMSSHPDRASHQRNQPSVSHAADRPAPMNRQASSLTQVSTTS
FT                   SGGAMKVKVFFQDDLIAIRVPSDISFQQLREKLLDRLKLNEEIVVQYKDEPSGAYMDLN
FT                   NDSDLDTAMQRNSKLTLHVGLA"
     MKAIRRSLKG EKDPKPHHHH LSITPKSAIA ILPPKKVIKA LYDYQPEPGN TQELAFSKGD        60
     FFHVISREDD LDWYEACNPL IPSARGLVPV SFFEVIGKNE RDSGGSVDLH KKKESHDSGF       120
     SDRGPAQFSS PDHTPTQLQH SPSTPRMSTL GKASSAMVYG IVQYDFQAER PDELDAKAGE       180
     AIIVIAQSNP EWFVAKPIGR LGGPGLIPVS FIELRDMQTG QAVSDPLEAV KRAGVPRVEE       240
     WKKMTAEYKN SSITLGKIDS AASAVQSVTS GVEKMSMGRN SAGHAGQNGN AYGYHNRNAS       300
     KASLPQHLSQ PPMPNHHQQP LVAPVAASIP RYCFDNDKYW YIIEAKMEDG RCWELSRYYH       360
     DFYDFQIALL TQFEEEAGNR GKPRTLPFMP GPVTHVTDAI SNGRRQNLDE YIKKLLAMPP       420
     HISRCQLVRQ LFAPRPGDFE IDPSAFGEDA RYSGGSHHSS TQETSRTASR QSSQAQMSSH       480
     PDRASHQRNQ PSVSHAADRP APMNRQASSL TQVSTTSSGG AMKVKVFFQD DLIAIRVPSD       540
     ISFQQLREKL LDRLKLNEEI VVQYKDEPSG AYMDLNNDSD LDTAMQRNSK LTLHVGLA         598
//

If you have problems or comments...

PBIL Back to PBIL home page