(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE304

ASFUM1_4.PE304       Location/Qualifiers
FT   CDS             join(1182850..1183261,1183377..1183893,1183970..1184165)
FT                   /codon_start=1
FT                   /gene_family="HOG000170652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259050"
FT                   /orf_name="AFUA_4G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84570.1"
FT                   /db_xref="HOGENOM:HBG054433"
FT                   /db_xref="UniParc:UPI00005201F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P3"
FT                   /transl_table=1
FT                   /translation="MAIHPTLPSQANSQGRLTPQQTRAISAWSEQAAASLRNLTLSESV
FT                   SASDRNVEFISTRDSPLRGSSVPLSIPLDDPAPVVHTGAVPRVKLVTRESETQPVASVS
FT                   FRRREPIRRDSLKRREALLKGKDGSRRRQRWENDRLLHNPWVEPPAPSDWAVQPTYPRH
FT                   DPMPYYLAPLWDMKYAHLDRTSSQQTQKGTRHEKHRVPKELRMRLKHARAARGMLQDLE
FT                   EDIRQFIQTWSEKQLMLRKEGLEDAPLSSEDESEDEVVFVGRNGQMHDSPEHKTRLREL
FT                   RANLSQHNERDGEKMVFESPVDDRAAGFGYYGLHTWSITVGEPARREAYVGFHMPAPGS
FT                   RPGLTTHVSVPSNAQQGAMMKPGDDLPKPLWAQI"
     MAIHPTLPSQ ANSQGRLTPQ QTRAISAWSE QAAASLRNLT LSESVSASDR NVEFISTRDS        60
     PLRGSSVPLS IPLDDPAPVV HTGAVPRVKL VTRESETQPV ASVSFRRREP IRRDSLKRRE       120
     ALLKGKDGSR RRQRWENDRL LHNPWVEPPA PSDWAVQPTY PRHDPMPYYL APLWDMKYAH       180
     LDRTSSQQTQ KGTRHEKHRV PKELRMRLKH ARAARGMLQD LEEDIRQFIQ TWSEKQLMLR       240
     KEGLEDAPLS SEDESEDEVV FVGRNGQMHD SPEHKTRLRE LRANLSQHNE RDGEKMVFES       300
     PVDDRAAGFG YYGLHTWSIT VGEPARREAY VGFHMPAPGS RPGLTTHVSV PSNAQQGAMM       360
     KPGDDLPKPL WAQI                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page