(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE305

ASFUM1_4.PE305       Location/Qualifiers
FT   CDS             join(1188106..1189178,1189468..1189492,1189628..1189876)
FT                   /codon_start=1
FT                   /gene_family="HOG000170641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259051"
FT                   /orf_name="AFUA_4G04230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84571.1"
FT                   /db_xref="HOGENOM:HBG054434"
FT                   /db_xref="HOGENOM:HBG327704"
FT                   /db_xref="UniParc:UPI00005201F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P2"
FT                   /transl_table=1
FT                   /translation="MESYSASSCQDRCARTRRSSGSTNSEASDRSKSTVPTVYSYRPTS
FT                   KRQPETDRFTMDPRDSTSTYASTIPSTDGLPEDPQYEVIDRKPEIYATDAIPSSPTTFA
FT                   ELFPSSRRLLIRHDDSTLDGNMNLRVDTLVPRRGGYQQDVILFHLRMYDLFSRKFSFRR
FT                   YCRESGREICHSERRPRSSSIDKRPILQRSWSSVLASLRPGSSGNGTIAGAEHKRHNSG
FT                   HHSIKQEGANLDDATADAKEYPSRPVALADTTVLEFSNYAHVEVKRRGAGIPKRYEFEY
FT                   WSTKYYWKKECRKEGDLREVSYHLINTRTSKIIAHIVPEILTPVEAVEEESKGGWVPSS
FT                   SMWISDSSVYEKMHEVAENLGKFAATAGSLACPCIWFAGDEDPSWTCLLVVVVVVVVVV
FT                   VVVVVVVVVVVVVVVVIVPRMCNRNSAASSYRCVDTCRSTESDDLLSGV"
     MESYSASSCQ DRCARTRRSS GSTNSEASDR SKSTVPTVYS YRPTSKRQPE TDRFTMDPRD        60
     STSTYASTIP STDGLPEDPQ YEVIDRKPEI YATDAIPSSP TTFAELFPSS RRLLIRHDDS       120
     TLDGNMNLRV DTLVPRRGGY QQDVILFHLR MYDLFSRKFS FRRYCRESGR EICHSERRPR       180
     SSSIDKRPIL QRSWSSVLAS LRPGSSGNGT IAGAEHKRHN SGHHSIKQEG ANLDDATADA       240
     KEYPSRPVAL ADTTVLEFSN YAHVEVKRRG AGIPKRYEFE YWSTKYYWKK ECRKEGDLRE       300
     VSYHLINTRT SKIIAHIVPE ILTPVEAVEE ESKGGWVPSS SMWISDSSVY EKMHEVAENL       360
     GKFAATAGSL ACPCIWFAGD EDPSWTCLLV VVVVVVVVVV VVVVVVVVVV VVVVVIVPRM       420
     CNRNSAASSY RCVDTCRSTE SDDLLSGV                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page