(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE311

ASFUM1_4.PE311       Location/Qualifiers
FT   CDS             1208179..1209039
FT                   /codon_start=1
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259054"
FT                   /orf_name="AFUA_4G04300"
FT                   /product="Alanine racemase family protein, putative "
FT                   /protein_id="EAL84577.1"
FT                   /db_xref="HOGENOM:HBG001447"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI00005201FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N6"
FT                   /transl_table=1
FT                   /translation="MTPTEQQEQEQPSPTSTTIMPASPSRTGTLLANLSSVTSRISTAA
FT                   LNANRPATKPIRLIAVSKLKPAADILALHNPPTNHLHFGENYLQELLEKSKLLPPSIRW
FT                   HFIGGLQSNKCVTLARDVRGLWAVESVDSEKKASLLDRGWGERSEEVRGVALEDRLRVF
FT                   VQVNTSGEENKAGVDPVAGAVPLARFIREKCPRLKLQGVMTIGAIARSKATTPETENED
FT                   FVCLRETRDRIVRELGLQGDDAELELSMGMSEDFEGAIKLGSDEVRVGTTIFGERPPKS
FT                   EAKVV"
     MTPTEQQEQE QPSPTSTTIM PASPSRTGTL LANLSSVTSR ISTAALNANR PATKPIRLIA        60
     VSKLKPAADI LALHNPPTNH LHFGENYLQE LLEKSKLLPP SIRWHFIGGL QSNKCVTLAR       120
     DVRGLWAVES VDSEKKASLL DRGWGERSEE VRGVALEDRL RVFVQVNTSG EENKAGVDPV       180
     AGAVPLARFI REKCPRLKLQ GVMTIGAIAR SKATTPETEN EDFVCLRETR DRIVRELGLQ       240
     GDDAELELSM GMSEDFEGAI KLGSDEVRVG TTIFGERPPK SEAKVV                      286
//

If you have problems or comments...

PBIL Back to PBIL home page