(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE312

ASFUM1_4.PE312       Location/Qualifiers
FT   CDS             join(complement(1211879..1212330),
FT                   complement(1211492..1211826),complement(1209514..1211432),
FT                   complement(1209346..1209459))
FT                   /codon_start=1
FT                   /gene_family="HOG000170596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206318"
FT                   /orf_name="AFUA_4G04310"
FT                   /product="AP-2 adaptor complex subunit alpha, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="EAL84578.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG315674"
FT                   /db_xref="HOGENOM:HBG354594"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI000051F8A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N5"
FT                   /transl_table=1
FT                   /translation="MSSMRGLVQFIADLRNARARELEEKRVNKELANIRQKFKAGNLNG
FT                   YQKKKYVCKLLYVYIQGYDVDFGHLEAVNLISSNKYSEKQIGYLAVTLFLHEQHELLHL
FT                   VVNSIRKDLLDNNELFNCLALHAVANVGGREMGEALSTDVHRLLISPTSKAFVKKKAAL
FT                   TLLRLYRKYPGIVQNEWAERMISLMDDPDMGVTLSVTSLIMALAQDRPEEYKGSYIKAA
FT                   QRLKRIVVDNEIAPDYLYYRVPCPWIQVKLLRLLQYYPPSQDSHVREIIRASLQQIMTT
FT                   AMDTPKNVQQNNAQNAILFEAINLLIHLDTEHNLMMQISSRLGKYIQSRETNVRYLGLE
FT                   AMTHFAARAETLDPIKKHQNIILGSLRDRDISVRRKGLDLIYSMCDTTNAAPIVNELLR
FT                   YLQTADYAIREEMVLKVAILTEKYATDAQWYIDITLKLLSLAGDHVNDEVWQRVIQIVT
FT                   NNEELQAYAAHTLLGYLKTDCHESLVKIGCYVLGEFGHLIADNEGSSPIEQFLALQGKM
FT                   ITSNDNTRAMILSSFIKFVNLFPEIKPQLLHIFRLYSHSPDTELQQRAFEYLTLATLPT
FT                   DDLLRTVCDEMPPFSERTSILLSRLHQKTAGTTEKKTWVVGGKDANADKKEVLLAQNTG
FT                   LKRTFTTIVNGTKTGANGSAATSNASGDLAGLDLSAPPAPPPNMASAAHLTPDWEPGYN
FT                   RLYFADEGVLFEDAQIQVGLRSEYRGHMGVVKIYISNKSSFAIGSLTTTLDNPAAPNLK
FT                   IDSKSLPEPSVPAAGQTQQTLLVEAHGPFSDAPTIRISYLAGALQAYTLQLPVLMHRYM
FT                   EPSTLSAEEFFKRWRQIGGPPLEAQHTFGVTAKAKNVSETFTRRLVEGFHWRILENVDP
FT                   NPNNIVGCAVYQSHGGKTGCLLRLEPNYERKMFRVTIRATQEAVPQALAKQMEQKLAQG
FT                   APDEMFGSR"
     MSSMRGLVQF IADLRNARAR ELEEKRVNKE LANIRQKFKA GNLNGYQKKK YVCKLLYVYI        60
     QGYDVDFGHL EAVNLISSNK YSEKQIGYLA VTLFLHEQHE LLHLVVNSIR KDLLDNNELF       120
     NCLALHAVAN VGGREMGEAL STDVHRLLIS PTSKAFVKKK AALTLLRLYR KYPGIVQNEW       180
     AERMISLMDD PDMGVTLSVT SLIMALAQDR PEEYKGSYIK AAQRLKRIVV DNEIAPDYLY       240
     YRVPCPWIQV KLLRLLQYYP PSQDSHVREI IRASLQQIMT TAMDTPKNVQ QNNAQNAILF       300
     EAINLLIHLD TEHNLMMQIS SRLGKYIQSR ETNVRYLGLE AMTHFAARAE TLDPIKKHQN       360
     IILGSLRDRD ISVRRKGLDL IYSMCDTTNA APIVNELLRY LQTADYAIRE EMVLKVAILT       420
     EKYATDAQWY IDITLKLLSL AGDHVNDEVW QRVIQIVTNN EELQAYAAHT LLGYLKTDCH       480
     ESLVKIGCYV LGEFGHLIAD NEGSSPIEQF LALQGKMITS NDNTRAMILS SFIKFVNLFP       540
     EIKPQLLHIF RLYSHSPDTE LQQRAFEYLT LATLPTDDLL RTVCDEMPPF SERTSILLSR       600
     LHQKTAGTTE KKTWVVGGKD ANADKKEVLL AQNTGLKRTF TTIVNGTKTG ANGSAATSNA       660
     SGDLAGLDLS APPAPPPNMA SAAHLTPDWE PGYNRLYFAD EGVLFEDAQI QVGLRSEYRG       720
     HMGVVKIYIS NKSSFAIGSL TTTLDNPAAP NLKIDSKSLP EPSVPAAGQT QQTLLVEAHG       780
     PFSDAPTIRI SYLAGALQAY TLQLPVLMHR YMEPSTLSAE EFFKRWRQIG GPPLEAQHTF       840
     GVTAKAKNVS ETFTRRLVEG FHWRILENVD PNPNNIVGCA VYQSHGGKTG CLLRLEPNYE       900
     RKMFRVTIRA TQEAVPQALA KQMEQKLAQG APDEMFGSR                              939
//

If you have problems or comments...

PBIL Back to PBIL home page