(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE313

ASFUM1_4.PE313       Location/Qualifiers
FT   CDS             join(complement(1213895..1214054),
FT                   complement(1213734..1213829),complement(1213602..1213681))
FT                   /codon_start=1
FT                   /gene_family="HOG000170574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259055"
FT                   /orf_name="AFUA_4G04318"
FT                   /product="Copper resistance protein Crd2, putative "
FT                   /protein_id="EBA27193.1"
FT                   /db_xref="HOGENOM:HBG324438"
FT                   /db_xref="UniParc:UPI0000F51AC7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA78"
FT                   /transl_table=1
FT                   /translation="MVHPSSTCCKTSGDGSCVCAAQAKCSCGKENALHCTCSRSAIENT
FT                   ISGPRCSCRARPAGQCTCERAAAENHPVTGDACPCGKRPSTSCTCEKVSAVDAAAEAIE
FT                   TDFTTRA"
     MVHPSSTCCK TSGDGSCVCA AQAKCSCGKE NALHCTCSRS AIENTISGPR CSCRARPAGQ        60
     CTCERAAAEN HPVTGDACPC GKRPSTSCTC EKVSAVDAAA EAIETDFTTR A                111
//

If you have problems or comments...

PBIL Back to PBIL home page