(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE317

ASFUM1_4.PE317       Location/Qualifiers
FT   CDS             join(complement(1233631..1233657),
FT                   complement(1233534..1233574),complement(1233449..1233461),
FT                   complement(1233275..1233382),complement(1233179..1233221),
FT                   complement(1233048..1233119),complement(1232926..1232976),
FT                   complement(1232674..1232752),complement(1232544..1232613))
FT                   /codon_start=1
FT                   /gene_family="HOG000170540" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259057"
FT                   /orf_name="AFUA_4G04355"
FT                   /product="PaaI_thioesterase family protein, putative "
FT                   /protein_id="EBA27194.1"
FT                   /db_xref="HOGENOM:HBG749290"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0000F51A76"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA79"
FT                   /transl_table=1
FT                   /translation="MTTLRFVRSVWESFRATSGLEPRLLDNYRTSVSGYTNSRSQLRVT
FT                   AARPGTVNFELDIQKEHTNRLSILHGGTIASMVDLGGSLAVASRGLFATGVSTDLNVTY
FT                   LSSGGKVGDKIQAVLGKTLAYTNIKFMNSKGEVFARGSHTKYIALAWKDPKNIVEELDG
FT                   RKES"
     MTTLRFVRSV WESFRATSGL EPRLLDNYRT SVSGYTNSRS QLRVTAARPG TVNFELDIQK        60
     EHTNRLSILH GGTIASMVDL GGSLAVASRG LFATGVSTDL NVTYLSSGGK VGDKIQAVLG       120
     KTLAYTNIKF MNSKGEVFAR GSHTKYIALA WKDPKNIVEE LDGRKES                     167
//

If you have problems or comments...

PBIL Back to PBIL home page