(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE319

ASFUM1_4.PE319       Location/Qualifiers
FT   CDS             complement(1236004..1237893)
FT                   /codon_start=1
FT                   /gene_family="HOG000170508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055335"
FT                   /orf_name="AFUA_4G04370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84584.1"
FT                   /db_xref="HOGENOM:HBG054442"
FT                   /db_xref="UniParc:UPI000051F18D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M9"
FT                   /transl_table=1
FT                   /translation="MSETRSRRASLLGSIQVLRSKTREGKHTYQRLGSERDSGPKDNDK
FT                   AGRIFSFGSFIPIKDESSILYSLRVKGRNSQIHEAWDSHRQVSMPLPTKSSSFGSQDSN
FT                   ETTASSEKSYRKIKISIRRLTARAGPSSSPSSSQTSSRSTSFTSSTSTSSSEHKYSKIP
FT                   VPTAHPVNGIHSRETYQKEGKRSLLSSLNKRYINLRRNASNDENKSISNIGTQETEDGD
FT                   LDIPTPPRLVKIAQNVRYVRPTEPVRVYRISRPVQAVQVNQPTLPTQPIQPVVPIELAK
FT                   SAENVQPTAESASVCEKCLEHQSKQTEMIEQRTEVVLDSSSKKFRSSITRTTSSSSSKA
FT                   ALIHLTSPRSSIPVPAKVRSPAKPCAPALQDGRKASEEQGINNNTRGSAIPVPNNATGL
FT                   NVKKVRFSEPLPQRQQTFTHHQLSDNQSAFICKITNRTLRSTSDMQPKKLRMSRGFANL
FT                   KALQTEEEVISQPASDDNQDQSVSKTSQQEQSANVPTTRNKAGTQRMVLPRDDNHTSRI
FT                   PGNKQRTLTTTIPAGFQVSEAQPRQYWLGRFMTLTNAFHYEDSFNEPDIATGFGMLSSY
FT                   SRPLGHPDANLANYRVKRAFMVLENVCVTEEASASLREFRDEYIAIHGDRWML"
     MSETRSRRAS LLGSIQVLRS KTREGKHTYQ RLGSERDSGP KDNDKAGRIF SFGSFIPIKD        60
     ESSILYSLRV KGRNSQIHEA WDSHRQVSMP LPTKSSSFGS QDSNETTASS EKSYRKIKIS       120
     IRRLTARAGP SSSPSSSQTS SRSTSFTSST STSSSEHKYS KIPVPTAHPV NGIHSRETYQ       180
     KEGKRSLLSS LNKRYINLRR NASNDENKSI SNIGTQETED GDLDIPTPPR LVKIAQNVRY       240
     VRPTEPVRVY RISRPVQAVQ VNQPTLPTQP IQPVVPIELA KSAENVQPTA ESASVCEKCL       300
     EHQSKQTEMI EQRTEVVLDS SSKKFRSSIT RTTSSSSSKA ALIHLTSPRS SIPVPAKVRS       360
     PAKPCAPALQ DGRKASEEQG INNNTRGSAI PVPNNATGLN VKKVRFSEPL PQRQQTFTHH       420
     QLSDNQSAFI CKITNRTLRS TSDMQPKKLR MSRGFANLKA LQTEEEVISQ PASDDNQDQS       480
     VSKTSQQEQS ANVPTTRNKA GTQRMVLPRD DNHTSRIPGN KQRTLTTTIP AGFQVSEAQP       540
     RQYWLGRFMT LTNAFHYEDS FNEPDIATGF GMLSSYSRPL GHPDANLANY RVKRAFMVLE       600
     NVCVTEEASA SLREFRDEYI AIHGDRWML                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page