(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE320

ASFUM1_4.PE320       Location/Qualifiers
FT   CDS             complement(1238344..1239306)
FT                   /codon_start=1
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750015"
FT                   /orf_name="AFUA_4G04380"
FT                   /product="Phenazine biosynthesis-like protein, putative "
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84585.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG437425"
FT                   /db_xref="HOGENOM:HBG563743"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniParc:UPI000052041C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M8"
FT                   /transl_table=1
FT                   /translation="MTEQVRFVTLDVFTSRPYAGNPLAVVFLPDSNKPAVTQQQKQSIA
FT                   REFNLSETIFVHSEKGEKRIIDIFTPDSELPFAGHPTIGAACWFLYLSPDEGDKGVVKT
FT                   LTTKSGDIPISLQLGQPWPAVTARIAHNTRLHQSRFPLQQLLRLHPFLSGFFRITGTVE
FT                   PAFPIFSIVNGMSQVHVELPSLEALAAVTTASGGEVISGGSGYLDEGWDAGLCVTYFYV
FT                   RNVKDPQTGANTIRTRAIFGNLEDPATGSAASGLAAYLSLMERKPGQYKYNIVQGVEIG
FT                   RRSEIGVEVVVNQDNKIDTVELQGGAVKVSEGNILLPPK"
     MTEQVRFVTL DVFTSRPYAG NPLAVVFLPD SNKPAVTQQQ KQSIAREFNL SETIFVHSEK        60
     GEKRIIDIFT PDSELPFAGH PTIGAACWFL YLSPDEGDKG VVKTLTTKSG DIPISLQLGQ       120
     PWPAVTARIA HNTRLHQSRF PLQQLLRLHP FLSGFFRITG TVEPAFPIFS IVNGMSQVHV       180
     ELPSLEALAA VTTASGGEVI SGGSGYLDEG WDAGLCVTYF YVRNVKDPQT GANTIRTRAI       240
     FGNLEDPATG SAASGLAAYL SLMERKPGQY KYNIVQGVEI GRRSEIGVEV VVNQDNKIDT       300
     VELQGGAVKV SEGNILLPPK                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page