(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE325

ASFUM1_4.PE325       Location/Qualifiers
FT   CDS             1249279..1250391
FT                   /codon_start=1
FT                   /gene_family="HOG000170475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902007"
FT                   /orf_name="AFUA_4G04430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84591.1"
FT                   /db_xref="HOGENOM:HBG054447"
FT                   /db_xref="HOGENOM:HBG327558"
FT                   /db_xref="UniParc:UPI000052020B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M2"
FT                   /transl_table=1
FT                   /translation="MAKQLRVSLTTTLTLLEQLQAALSAPAEDPKPAELSGKDALPLLS
FT                   TSATALKSQVTKLSLLTITSPFTHSAVGTVLSALNSSVLPSLVTGALLVTPADHTKAFH
FT                   AEVHALTKTTLRELTSLVTEVQAVAEKADKAKEGQRKGGKLLQAEKDPVTVATGRVWDS
FT                   CDALIDVAAKGVVGFVIRRVEEWRDLVRDAVEEIEEWDPEEDGDEFFDDLLSDDGEKDT
FT                   QDEEDEDTEESSATLHAQKKSTLRILKPIAQIYPAIVANRLKGAGDVPCSSPSGIGRLE
FT                   RLMTNLQHIPEHIDEVAGALYEEDLGKCAQYLDKAKHCAMNAVDSVKPTWDTVDATDGQ
FT                   QKEDKFAIWSKTWMNVLDEVSKSVEADNQE"
     MAKQLRVSLT TTLTLLEQLQ AALSAPAEDP KPAELSGKDA LPLLSTSATA LKSQVTKLSL        60
     LTITSPFTHS AVGTVLSALN SSVLPSLVTG ALLVTPADHT KAFHAEVHAL TKTTLRELTS       120
     LVTEVQAVAE KADKAKEGQR KGGKLLQAEK DPVTVATGRV WDSCDALIDV AAKGVVGFVI       180
     RRVEEWRDLV RDAVEEIEEW DPEEDGDEFF DDLLSDDGEK DTQDEEDEDT EESSATLHAQ       240
     KKSTLRILKP IAQIYPAIVA NRLKGAGDVP CSSPSGIGRL ERLMTNLQHI PEHIDEVAGA       300
     LYEEDLGKCA QYLDKAKHCA MNAVDSVKPT WDTVDATDGQ QKEDKFAIWS KTWMNVLDEV       360
     SKSVEADNQE                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page