(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE326

ASFUM1_4.PE326       Location/Qualifiers
FT   CDS             complement(1250690..1253686)
FT                   /codon_start=1
FT                   /gene_family="HOG000170464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206589"
FT                   /orf_name="AFUA_4G04440"
FT                   /product="Conserved leucine-rich repeat protein "
FT                   /protein_id="EAL84592.1"
FT                   /db_xref="HOGENOM:HBG054448"
FT                   /db_xref="HOGENOM:HBG327549"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000051E5A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M1"
FT                   /transl_table=1
FT                   /translation="MDQQQKTPTRPSGIPRLAASRLPLPTSSTSRSVKPSPSREKLRAD
FT                   PGLDATRLRRPSEQPVLKKPPPKHPLSYRTPEKPRQKRDTSNGGLSNGGRSENAGDASE
FT                   EAPMLGTDAAVGDAERRGRPRPSLSERTIETLSRIPPSPGPPSRQSSFFNGNSPVRSPS
FT                   RTPSVMTSRSPSRASTTRQPSENDFLSQQASAIQLPSRSRISPAPTLSSNDASTGQRTS
FT                   SAGTDISSTLKKPSVRASLYNGVNDTTRKSPDPRPALGKTSANATFSDMGPPPPPLHVK
FT                   KTRKSLANNSSPINNSRKPSTPLNAPDLSIEQQSEIEMRKASKSSSALRESIAKAKAAR
FT                   KASARQNNTQNGSVDIFDNLNVEDPFNQQPKDSKSGLLRKRVEAGRTSGHLNIAAMSLT
FT                   EIPKEVMAMYDFDPNSTTDWYESVDLVKFIAADNEFVELSEAAFPDIDPFDIDSDKDER
FT                   GNQFAGLEIMDLHGNQLRTLPMGFRRLQRLHTLNLSNNKLDAESIQIVMQMEALKDLKL
FT                   ANNLLEGSFSSDVKNLTRLEVLDLRGNSLTELPKSLEYLACLRILDVGDNQLTSLPFQS
FT                   LGMLPLKDLRAPRNKLAGTLIPASLSKLDSLQSLDVTGNALTAISEREDLEMPSLQTLS
FT                   ISMNRIKHLPNICTWTALLTLSAEDNSLSAIPQGFVELQNLRNVDFTGNNISKLDERIG
FT                   LMEGLSTLRLANNPLRERKFLTMNTDDIKRDLRNRCEPEPQDTDDDEGSVATQFTLAPE
FT                   TPAQMTSWQVKPGGILDRSYSELSEVDVKQLERINFNDIRCVYLQHNSLTCIPVPAFSM
FT                   LAHCLTDLDLSNNPLDSLSVLSTSLTLPNLHILNLSAAKLTTIEPILANLTAPCLTTLD
FT                   ISYNRLSGPLPAVRQVYPNLMTFLAADNGFQSLDFEAVQGLQVLDVSNNNISSLPPKLG
FT                   LLRAEGCSKNWGTGSPLRRFEVAGNSFRVPRWQVVAKGTDAILDWLKDRIRSEDLAEWE
FT                   PDEESTVHV"
     MDQQQKTPTR PSGIPRLAAS RLPLPTSSTS RSVKPSPSRE KLRADPGLDA TRLRRPSEQP        60
     VLKKPPPKHP LSYRTPEKPR QKRDTSNGGL SNGGRSENAG DASEEAPMLG TDAAVGDAER       120
     RGRPRPSLSE RTIETLSRIP PSPGPPSRQS SFFNGNSPVR SPSRTPSVMT SRSPSRASTT       180
     RQPSENDFLS QQASAIQLPS RSRISPAPTL SSNDASTGQR TSSAGTDISS TLKKPSVRAS       240
     LYNGVNDTTR KSPDPRPALG KTSANATFSD MGPPPPPLHV KKTRKSLANN SSPINNSRKP       300
     STPLNAPDLS IEQQSEIEMR KASKSSSALR ESIAKAKAAR KASARQNNTQ NGSVDIFDNL       360
     NVEDPFNQQP KDSKSGLLRK RVEAGRTSGH LNIAAMSLTE IPKEVMAMYD FDPNSTTDWY       420
     ESVDLVKFIA ADNEFVELSE AAFPDIDPFD IDSDKDERGN QFAGLEIMDL HGNQLRTLPM       480
     GFRRLQRLHT LNLSNNKLDA ESIQIVMQME ALKDLKLANN LLEGSFSSDV KNLTRLEVLD       540
     LRGNSLTELP KSLEYLACLR ILDVGDNQLT SLPFQSLGML PLKDLRAPRN KLAGTLIPAS       600
     LSKLDSLQSL DVTGNALTAI SEREDLEMPS LQTLSISMNR IKHLPNICTW TALLTLSAED       660
     NSLSAIPQGF VELQNLRNVD FTGNNISKLD ERIGLMEGLS TLRLANNPLR ERKFLTMNTD       720
     DIKRDLRNRC EPEPQDTDDD EGSVATQFTL APETPAQMTS WQVKPGGILD RSYSELSEVD       780
     VKQLERINFN DIRCVYLQHN SLTCIPVPAF SMLAHCLTDL DLSNNPLDSL SVLSTSLTLP       840
     NLHILNLSAA KLTTIEPILA NLTAPCLTTL DISYNRLSGP LPAVRQVYPN LMTFLAADNG       900
     FQSLDFEAVQ GLQVLDVSNN NISSLPPKLG LLRAEGCSKN WGTGSPLRRF EVAGNSFRVP       960
     RWQVVAKGTD AILDWLKDRI RSEDLAEWEP DEESTVHV                               998
//

If you have problems or comments...

PBIL Back to PBIL home page