(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE329

ASFUM1_4.PE329       Location/Qualifiers
FT   CDS             join(complement(1260825..1261723),
FT                   complement(1259787..1260768))
FT                   /codon_start=1
FT                   /gene_family="HOG000170431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260031"
FT                   /orf_name="AFUA_4G04465"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27195.1"
FT                   /db_xref="HOGENOM:HBG324442"
FT                   /db_xref="UniParc:UPI0000F51A98"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA80"
FT                   /transl_table=1
FT                   /translation="MSSQPLRGDARTRPSRIPTFQAPTKASLARSHPELLERAHNKSPG
FT                   KDRNQDDQQKQAEAGVFGLRDRKAFRPSLASTASPVRTARQVGDARSPFSTRRSSGIQA
FT                   FAAPPRRVPRKITPADFVFGSPANLPNTVANPEPINTPEDQLASELGSATGEVNVSINS
FT                   EQPPLHEEFEEPDLPPTPTQLGLENPPERPRGLLSSSPSTQLEKFRTRRTGELLEKSPS
FT                   KLRKVDYGRQTGDQSGLGVIVSKEFLPEPVVKKQKLKKELSADLRKLKEDIAELESWSE
FT                   RFGQQHETMESDHDLDKLISILVTEDPVSKNVKRPAANPSISSLLSALLPFSTKFAPSI
FT                   QQSPTPTNPFALAASARAKPYLTVFAPLNLTAHSNTTSDSKNDTLLEKHHLTLTAPAPF
FT                   PSNVYSIPVVYETNTELLCLTSISVPTSPGTSLTKIPIPLRRWIDSRLSNPLLKLDITG
FT                   LCQGISQYWEAMLSRALVWSEIENRHANLLGRPALVGAPGKSNTQQGQDDRSNSRRLLP
FT                   HLKRSTMLFESKENRMKLLLSCDLSMDEWSSEPKLTTDISIASRSTSNGTSCRKIELET
FT                   KKLFREVLRDFRRQQGANETEADAIIRAVECVLNALFGVEAGGELSKVHA"
     MSSQPLRGDA RTRPSRIPTF QAPTKASLAR SHPELLERAH NKSPGKDRNQ DDQQKQAEAG        60
     VFGLRDRKAF RPSLASTASP VRTARQVGDA RSPFSTRRSS GIQAFAAPPR RVPRKITPAD       120
     FVFGSPANLP NTVANPEPIN TPEDQLASEL GSATGEVNVS INSEQPPLHE EFEEPDLPPT       180
     PTQLGLENPP ERPRGLLSSS PSTQLEKFRT RRTGELLEKS PSKLRKVDYG RQTGDQSGLG       240
     VIVSKEFLPE PVVKKQKLKK ELSADLRKLK EDIAELESWS ERFGQQHETM ESDHDLDKLI       300
     SILVTEDPVS KNVKRPAANP SISSLLSALL PFSTKFAPSI QQSPTPTNPF ALAASARAKP       360
     YLTVFAPLNL TAHSNTTSDS KNDTLLEKHH LTLTAPAPFP SNVYSIPVVY ETNTELLCLT       420
     SISVPTSPGT SLTKIPIPLR RWIDSRLSNP LLKLDITGLC QGISQYWEAM LSRALVWSEI       480
     ENRHANLLGR PALVGAPGKS NTQQGQDDRS NSRRLLPHLK RSTMLFESKE NRMKLLLSCD       540
     LSMDEWSSEP KLTTDISIAS RSTSNGTSCR KIELETKKLF REVLRDFRRQ QGANETEADA       600
     IIRAVECVLN ALFGVEAGGE LSKVHA                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page