(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE332

ASFUM1_4.PE332       Location/Qualifiers
FT   CDS             join(complement(1266706..1267058),
FT                   complement(1266489..1266587),complement(1266356..1266423),
FT                   complement(1265948..1266291),complement(1265819..1265888),
FT                   complement(1264941..1265758))
FT                   /codon_start=1
FT                   /gene_family="HOG000170398" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260033"
FT                   /orf_name="AFUA_4G04502"
FT                   /product="Flocculation suppression protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27196.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG324444"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000F51A5A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA69"
FT                   /transl_table=1
FT                   /translation="MSSLADPPSQNTFTAGPADAAGKTRKLPVLPSSIPSSVQSTGDSM
FT                   EVTPPASTTTGPAPPAHSSPDSDRAGANTANSNGSVETGNMNNTSMANQAIGAAAAAQQ
FT                   PKVVQTAFIHKLYNMLEDPSIQHLISWSSTNDSFVMSPTSEFSKVLAQYFKHTNISSFV
FT                   RQLNMYGFHKVSDVFHTGSPDSALWEFKHGNGNFKRGDLVGLREIKRRASRHALIHRDS
FT                   FPGHKTAVSQPGTPAEPVPDATEARLLNLEHSLYDMHTRLSRAEEAHTALNLRCQAMAE
FT                   SLARCHHWAYSISQFLQGTIPDRDSPLYRDVSSMQKEIEKHLDVVRTLENPPDPYLSVR
FT                   PPFFANVSVDPGPPLSPRQVPQDDSRRPSMMDPSRQNIIRPPVPPHLAVSPRRYGSIGG
FT                   GNSSPNYNRPQVPSVVPPQQPVPHPLSSVSSPPGPNLARRHTSADIRQHGWPPPNVSQF
FT                   PPANAPGAPATPWPPSPHRTPTSSEQQVRDVLAQYEMGVSRRFQSSSRHATPPLNSDQP
FT                   SSTLTVDNTWTYGGSKYARHESSLPATRRSSMASNVHSLLNPADTAERPEEDQHNNLED
FT                   RKRKRLE"
     MSSLADPPSQ NTFTAGPADA AGKTRKLPVL PSSIPSSVQS TGDSMEVTPP ASTTTGPAPP        60
     AHSSPDSDRA GANTANSNGS VETGNMNNTS MANQAIGAAA AAQQPKVVQT AFIHKLYNML       120
     EDPSIQHLIS WSSTNDSFVM SPTSEFSKVL AQYFKHTNIS SFVRQLNMYG FHKVSDVFHT       180
     GSPDSALWEF KHGNGNFKRG DLVGLREIKR RASRHALIHR DSFPGHKTAV SQPGTPAEPV       240
     PDATEARLLN LEHSLYDMHT RLSRAEEAHT ALNLRCQAMA ESLARCHHWA YSISQFLQGT       300
     IPDRDSPLYR DVSSMQKEIE KHLDVVRTLE NPPDPYLSVR PPFFANVSVD PGPPLSPRQV       360
     PQDDSRRPSM MDPSRQNIIR PPVPPHLAVS PRRYGSIGGG NSSPNYNRPQ VPSVVPPQQP       420
     VPHPLSSVSS PPGPNLARRH TSADIRQHGW PPPNVSQFPP ANAPGAPATP WPPSPHRTPT       480
     SSEQQVRDVL AQYEMGVSRR FQSSSRHATP PLNSDQPSST LTVDNTWTYG GSKYARHESS       540
     LPATRRSSMA SNVHSLLNPA DTAERPEEDQ HNNLEDRKRK RLE                         583
//

If you have problems or comments...

PBIL Back to PBIL home page