(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE334

ASFUM1_4.PE334       Location/Qualifiers
FT   CDS             join(complement(1273294..1273350),
FT                   complement(1273118..1273201),complement(1272983..1273055),
FT                   complement(1272822..1272921),complement(1272204..1272749),
FT                   complement(1272096..1272142),complement(1271752..1272044),
FT                   complement(1271548..1271682))
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206591"
FT                   /orf_name="AFUA_4G04520"
FT                   /product="Succinyl-CoA synthetase beta subunit, putative "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="EAL84600.1"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG130207"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI000051F64D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L3"
FT                   /transl_table=1
FT                   /translation="MFKLARSSRPVAAAIRAATESSVQFRLAQQQRNLSIHEYLSARLL
FT                   KSYGVGVPKGEVAHSAEEAEAVAKSIGNDDMVIKAQVLAGGRGKGSFDNGLKGGVRVIY
FT                   SPTEAKMFASQMIGHKLITKQTGAAGRLCNAVYICERKFARREFYLAVLMDRATQTPVI
FT                   VASSQGGMDIEAVAKEHPEAIMTTPIDIKVGVTDDIARKIATDLGFSEQCIEDAKTTIQ
FT                   NLYKVFMEKDATQIEINPLSETSDHQVLAMDAKLNFDDNAEFRQKEVFSWRDTTQEDAD
FT                   EVKAAEYGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPAAIKS
FT                   AFELITSDPKVTAIFVNIFGGIVRCDAIARGLINVVEDMGLRIPIVARLQGTNMEQAQK
FT                   LINESGLKIFSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI"
     MFKLARSSRP VAAAIRAATE SSVQFRLAQQ QRNLSIHEYL SARLLKSYGV GVPKGEVAHS        60
     AEEAEAVAKS IGNDDMVIKA QVLAGGRGKG SFDNGLKGGV RVIYSPTEAK MFASQMIGHK       120
     LITKQTGAAG RLCNAVYICE RKFARREFYL AVLMDRATQT PVIVASSQGG MDIEAVAKEH       180
     PEAIMTTPID IKVGVTDDIA RKIATDLGFS EQCIEDAKTT IQNLYKVFME KDATQIEINP       240
     LSETSDHQVL AMDAKLNFDD NAEFRQKEVF SWRDTTQEDA DEVKAAEYGL NFIKLDGDIG       300
     CLVNGAGLAM ATMDIIKLNG GNPANFLDVG GGATPAAIKS AFELITSDPK VTAIFVNIFG       360
     GIVRCDAIAR GLINVVEDMG LRIPIVARLQ GTNMEQAQKL INESGLKIFS IEDLQSAAEK       420
     SVQFSKVVKM AREIDVGVEF TLGI                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page