(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE336

ASFUM1_4.PE336       Location/Qualifiers
FT   CDS             join(1276853..1277556,1277612..1277960)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260035"
FT                   /orf_name="AFUA_4G04540"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84602.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054456"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI0000520429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L1"
FT                   /transl_table=1
FT                   /translation="MVYSAAAILPISIYLQIITHASNRVIVCACVYRLIRNNVDQYFSV
FT                   RSRGYRTLAKSCRRCVILDRCGSCSDPLCRYLPATVCDILLAHYMMECSPCLRWSTQTF
FT                   TIAQMTPIWIFPAYPMLIIGPHAGILSAKLEPSRALPIIIGGTTIQGIGLLVTLTVYSA
FT                   YVYRLFSQKLPRENLRPGMFVSVGPSAFTVSGLVTMAAHAKRCFPDDFMGNGALAANIL
FT                   EVVVNFACLWLWGLAIFFFFIATFAHWSTIGPGRMNFSMAWFSFVFPNTALITATFAIG
FT                   NAFSCKPILIIGCAMIFPLILMYIFVFYMMIRAIVLRQIMWPQKGEDKDEGGFEINRTK
FT                   PETPGEQTPV"
     MVYSAAAILP ISIYLQIITH ASNRVIVCAC VYRLIRNNVD QYFSVRSRGY RTLAKSCRRC        60
     VILDRCGSCS DPLCRYLPAT VCDILLAHYM MECSPCLRWS TQTFTIAQMT PIWIFPAYPM       120
     LIIGPHAGIL SAKLEPSRAL PIIIGGTTIQ GIGLLVTLTV YSAYVYRLFS QKLPRENLRP       180
     GMFVSVGPSA FTVSGLVTMA AHAKRCFPDD FMGNGALAAN ILEVVVNFAC LWLWGLAIFF       240
     FFIATFAHWS TIGPGRMNFS MAWFSFVFPN TALITATFAI GNAFSCKPIL IIGCAMIFPL       300
     ILMYIFVFYM MIRAIVLRQI MWPQKGEDKD EGGFEINRTK PETPGEQTPV                  350
//

If you have problems or comments...

PBIL Back to PBIL home page