(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE338

ASFUM1_4.PE338       Location/Qualifiers
FT   CDS             join(1281588..1281939,1282186..1282302,1282535..1283763)
FT                   /codon_start=1
FT                   /gene_family="HOG000170376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206592"
FT                   /orf_name="AFUA_4G04560"
FT                   /product="GTP binding protein, putative "
FT                   /function="binding"
FT                   /protein_id="EAL84604.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054457"
FT                   /db_xref="HOGENOM:HBG327466"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F889"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K9"
FT                   /transl_table=1
FT                   /translation="MISDNEPDMVHTTGPDTEDQLAKETSSKAQNDIDCPSLGQILSQL
FT                   SPPPSTLPVQTLSLVPVDEQEVLLRRLEDVLAEATGGAESFEEVQTILNELWKCQSSYL
FT                   AQAADALANGSRNDENRALVVKGNYTAAILNRLSPELVHVVIPVIYNISIDYEQGIRES
FT                   PGGTILLLLDLLSEEGVALSQFVGLANCLMSYLDKERFQDICISQCMVDRVLSVLKQSL
FT                   YIKADPSSNGDTKALAQLQLKINQTLSEVSASPKFSEVYPLGSPLVQTLKDWLASTEDQ
FT                   LQICSCVMLGNLARSDAVCEIMVRKMNIHTMLISILRSDARGAVLHSALGILKNLAIAG
FT                   ENRQSLGDARIIPAVSRLWGYETVPQVQFAATSIVRQVIISSTANISCLLGLAPIDEDS
FT                   SASGQTYLSSLLSLCEKTDSTPIKTEVGRIVASICRTIVPKSREADSEASTLLERLFTM
FT                   HQSVALPLGAMIAQSQWPVVRSEGWFALALMASSKHGTGAVIDCLQKLDLYPLLEETMS
FT                   TPVSDSADDADKLKAAKDRDNIVVLIQELLKNDVSQKQFSSPISAGVY"
     MISDNEPDMV HTTGPDTEDQ LAKETSSKAQ NDIDCPSLGQ ILSQLSPPPS TLPVQTLSLV        60
     PVDEQEVLLR RLEDVLAEAT GGAESFEEVQ TILNELWKCQ SSYLAQAADA LANGSRNDEN       120
     RALVVKGNYT AAILNRLSPE LVHVVIPVIY NISIDYEQGI RESPGGTILL LLDLLSEEGV       180
     ALSQFVGLAN CLMSYLDKER FQDICISQCM VDRVLSVLKQ SLYIKADPSS NGDTKALAQL       240
     QLKINQTLSE VSASPKFSEV YPLGSPLVQT LKDWLASTED QLQICSCVML GNLARSDAVC       300
     EIMVRKMNIH TMLISILRSD ARGAVLHSAL GILKNLAIAG ENRQSLGDAR IIPAVSRLWG       360
     YETVPQVQFA ATSIVRQVII SSTANISCLL GLAPIDEDSS ASGQTYLSSL LSLCEKTDST       420
     PIKTEVGRIV ASICRTIVPK SREADSEAST LLERLFTMHQ SVALPLGAMI AQSQWPVVRS       480
     EGWFALALMA SSKHGTGAVI DCLQKLDLYP LLEETMSTPV SDSADDADKL KAAKDRDNIV       540
     VLIQELLKND VSQKQFSSPI SAGVY                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page