(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE34

ASFUM1_4.PE34        Location/Qualifiers
FT   CDS             join(116378..116511,117018..117675)
FT                   /codon_start=1
FT                   /gene_family="HOG000048689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273688"
FT                   /orf_name="AFUA_4G00450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84373.1"
FT                   /db_xref="HOGENOM:HBG054171"
FT                   /db_xref="UniParc:UPI000051F4D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W968"
FT                   /transl_table=1
FT                   /translation="MASFNPNIPVRGNPFLDIPSDIDAHPFRLVWEDICSVSYLARLLP
FT                   KGVILDLVECLIQRDLEYKTADIRQGRAQLRAALAASTTKKAVLIVHSQGGIVASSIID
FT                   WLYGELSQSQIQKLEIYTFGNAARQFRNPPLHELHHNDPAGTTPRRQIQGERAIRNIEH
FT                   YANTKDFVANIGALQFTASAGAYSNASVFSGTVFIREGSGHLFNMHYLHPMFGEHSAFM
FT                   ESTVDVRPRNGPGKTVSMRMRELSRLYNYKNGRSPEDEDAM"
     MASFNPNIPV RGNPFLDIPS DIDAHPFRLV WEDICSVSYL ARLLPKGVIL DLVECLIQRD        60
     LEYKTADIRQ GRAQLRAALA ASTTKKAVLI VHSQGGIVAS SIIDWLYGEL SQSQIQKLEI       120
     YTFGNAARQF RNPPLHELHH NDPAGTTPRR QIQGERAIRN IEHYANTKDF VANIGALQFT       180
     ASAGAYSNAS VFSGTVFIRE GSGHLFNMHY LHPMFGEHSA FMESTVDVRP RNGPGKTVSM       240
     RMRELSRLYN YKNGRSPEDE DAM                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page