(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE346

ASFUM1_4.PE346       Location/Qualifiers
FT   CDS             join(1298065..1298415,1298510..1299112)
FT                   /codon_start=1
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750019"
FT                   /orf_name="AFUA_4G04630"
FT                   /product="Golgi membrane protein, putative "
FT                   /protein_id="EAL84611.1"
FT                   /db_xref="HOGENOM:HBG191785"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="UniParc:UPI000051FFD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K2"
FT                   /transl_table=1
FT                   /translation="MAQYYPQQQPYGSQASPQNLQFYPSSYTSVSGHTTPSQATYGGFG
FT                   GPSGSTAQAYPVGGVGSGYGGFGSPAAGVSGRMGEQGGLRTGWLAAFGTEGYEGEPPLL
FT                   EELGVNFEHIRTKTLTVLNPFARIDQHLMDDSDLYGALLYIVLYGTFLLLSGKVFYGYI
FT                   YGVAVFGTVVLHLILSLMSPALDTASAPNAADPSNYDPHHKPTMSDASSVGHFSATLTF
FT                   PRSASVLGYCFLPLVLTSLVGILIPMDTLFGYLLTTAAVGWCTYSSSGMFCAVARMRGM
FT                   RGLVAYPLALFYVVFGIMGIFSSRGSGTLAAKTGAA"
     MAQYYPQQQP YGSQASPQNL QFYPSSYTSV SGHTTPSQAT YGGFGGPSGS TAQAYPVGGV        60
     GSGYGGFGSP AAGVSGRMGE QGGLRTGWLA AFGTEGYEGE PPLLEELGVN FEHIRTKTLT       120
     VLNPFARIDQ HLMDDSDLYG ALLYIVLYGT FLLLSGKVFY GYIYGVAVFG TVVLHLILSL       180
     MSPALDTASA PNAADPSNYD PHHKPTMSDA SSVGHFSATL TFPRSASVLG YCFLPLVLTS       240
     LVGILIPMDT LFGYLLTTAA VGWCTYSSSG MFCAVARMRG MRGLVAYPLA LFYVVFGIMG       300
     IFSSRGSGTL AAKTGAA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page