(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE347

ASFUM1_4.PE347       Location/Qualifiers
FT   CDS             complement(1299450..1301837)
FT                   /codon_start=1
FT                   /gene_family="HOG000170297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260041"
FT                   /orf_name="AFUA_4G04640"
FT                   /product="Ubiquitin fusion degradation protein (Ufd1),
FT                   putative"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL84612.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG054463"
FT                   /db_xref="HOGENOM:HBG327424"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI0000520924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K1"
FT                   /transl_table=1
FT                   /translation="MAREQDLLQWSSQFFVAAPQRTPKLPGDKITLPQSALEQLLAAAP
FT                   LSDVSPQGSLRQYTSTFDPFNPHTFAAESRARAQQLDRQKQLPHPLTFRLVNPNNERAI
FT                   YAGIREFSAAEGEVGLSGFLRQALDIEDEPFQLQTGEHGTETAHSPDLNNREGSGSVRS
FT                   TRHSTPTITVHAKQLPKGTYVRLRPLEAGYDPEDWKALLERYLRDNFTTLTIGELLSVS
FT                   GNRNERFRFLVDKVEPEGDGICVVDTDLEVDIVALTEDQARETLQRRLEKASRAPGTKG
FT                   GSSIGGVLALGETVTGQVIPGEYVDYELSRWDGEETIEVEVEGIDDAVVYLFASPFSSH
FT                   QRNRPRLDEHVFADFSSQPSKKLRIRPTNIELDGAEALYLSVHAYSQTEAGAGMASSQT
FT                   LPLRYSMRVVQSSSAIQREQTAAQLDTHEPGDVQCKNCHQWVPQRTLVLHENFCLRNNV
FT                   LCPQCGNVFQKRSPEWDNHWHCPHDSSHGNDIPSKDRHDGIFHTRRLCPDCGFEADSLP
FT                   SLAQHRTTVCPEKPILCQFCHLVVPQRGETDPDMLDPEVLLSGLTPHELVDGGRTTECH
FT                   LCNKIIRLRDMKTHLRHHDLERLSRPAPRICLNQNCGRTLDARAAQSTITPGTDTLGLC
FT                   SICFGPLYVDTYDPEGKLLRRRIERRYLSQLMSGCGKPWCQNEYCKTGKQHRLSINTSD
FT                   GGTTSMSVAQILTLVRPLIDAINLRRDAPNTAPFYLCTDQVSQQRRIQAEMIAAEGAMT
FT                   GGKAYDLPWCVAAVEATAGDLDKAREWLTNWAPARDEEQTFC"
     MAREQDLLQW SSQFFVAAPQ RTPKLPGDKI TLPQSALEQL LAAAPLSDVS PQGSLRQYTS        60
     TFDPFNPHTF AAESRARAQQ LDRQKQLPHP LTFRLVNPNN ERAIYAGIRE FSAAEGEVGL       120
     SGFLRQALDI EDEPFQLQTG EHGTETAHSP DLNNREGSGS VRSTRHSTPT ITVHAKQLPK       180
     GTYVRLRPLE AGYDPEDWKA LLERYLRDNF TTLTIGELLS VSGNRNERFR FLVDKVEPEG       240
     DGICVVDTDL EVDIVALTED QARETLQRRL EKASRAPGTK GGSSIGGVLA LGETVTGQVI       300
     PGEYVDYELS RWDGEETIEV EVEGIDDAVV YLFASPFSSH QRNRPRLDEH VFADFSSQPS       360
     KKLRIRPTNI ELDGAEALYL SVHAYSQTEA GAGMASSQTL PLRYSMRVVQ SSSAIQREQT       420
     AAQLDTHEPG DVQCKNCHQW VPQRTLVLHE NFCLRNNVLC PQCGNVFQKR SPEWDNHWHC       480
     PHDSSHGNDI PSKDRHDGIF HTRRLCPDCG FEADSLPSLA QHRTTVCPEK PILCQFCHLV       540
     VPQRGETDPD MLDPEVLLSG LTPHELVDGG RTTECHLCNK IIRLRDMKTH LRHHDLERLS       600
     RPAPRICLNQ NCGRTLDARA AQSTITPGTD TLGLCSICFG PLYVDTYDPE GKLLRRRIER       660
     RYLSQLMSGC GKPWCQNEYC KTGKQHRLSI NTSDGGTTSM SVAQILTLVR PLIDAINLRR       720
     DAPNTAPFYL CTDQVSQQRR IQAEMIAAEG AMTGGKAYDL PWCVAAVEAT AGDLDKAREW       780
     LTNWAPARDE EQTFC                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page