(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE348

ASFUM1_4.PE348       Location/Qualifiers
FT   CDS             complement(1302864..1304483)
FT                   /codon_start=1
FT                   /gene_family="HOG000170286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750020"
FT                   /orf_name="AFUA_4G04650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84613.1"
FT                   /db_xref="HOGENOM:HBG054464"
FT                   /db_xref="HOGENOM:HBG327417"
FT                   /db_xref="UniParc:UPI000052020D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K0"
FT                   /transl_table=1
FT                   /translation="MMAEGELWYSLVTAIDPVNIKAMPAVLQSTINLLENELAKARAAL
FT                   KEIQPNAAPRFTVGDELATGAIAAYRQNLIGRAPDFYYGTQRLTPKELGLVPVVREVQV
FT                   TSEEEEAPQEESQCSVTVIPSKPASLTDVLSNSLILDHMAPYLSISGLLSLASTCRALR
FT                   SVVMETPYVFRHLDLSRCRGAQLQRSSADNGRAQALGNEPMDESLTEDEFYSAPLKKIF
FT                   AKLEHKSLLQDVRTLILDGLPVPADLIADILLNDRFNVNILSIRGCQHLNERKLMQVLQ
FT                   YAVRPTRPAGTPRVKGIYFFTPLNLAQAAARSRYRKWWSSRCAGQTPVEARPSSRQHDQ
FT                   GRETDRQNVWYSPSGKLLTASIEEGWAQTIQKCHGIIAFDAVLCRGPRHDPNAMLVGQD
FT                   GSQREGRLLGPAIATIALGSRGCDGCHSSPEGPAIWGQSPEETFPLLTPPPFHSSSVVA
FT                   AKRPSLFPGADHPALIARCADCLTDRWCHRCNKWFCADCLPNPQRVSSNLSPHQTALRA
FT                   SLGTNDSSQVCKLECSYSEPRR"
     MMAEGELWYS LVTAIDPVNI KAMPAVLQST INLLENELAK ARAALKEIQP NAAPRFTVGD        60
     ELATGAIAAY RQNLIGRAPD FYYGTQRLTP KELGLVPVVR EVQVTSEEEE APQEESQCSV       120
     TVIPSKPASL TDVLSNSLIL DHMAPYLSIS GLLSLASTCR ALRSVVMETP YVFRHLDLSR       180
     CRGAQLQRSS ADNGRAQALG NEPMDESLTE DEFYSAPLKK IFAKLEHKSL LQDVRTLILD       240
     GLPVPADLIA DILLNDRFNV NILSIRGCQH LNERKLMQVL QYAVRPTRPA GTPRVKGIYF       300
     FTPLNLAQAA ARSRYRKWWS SRCAGQTPVE ARPSSRQHDQ GRETDRQNVW YSPSGKLLTA       360
     SIEEGWAQTI QKCHGIIAFD AVLCRGPRHD PNAMLVGQDG SQREGRLLGP AIATIALGSR       420
     GCDGCHSSPE GPAIWGQSPE ETFPLLTPPP FHSSSVVAAK RPSLFPGADH PALIARCADC       480
     LTDRWCHRCN KWFCADCLPN PQRVSSNLSP HQTALRASLG TNDSSQVCKL ECSYSEPRR        539
//

If you have problems or comments...

PBIL Back to PBIL home page