(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE349

ASFUM1_4.PE349       Location/Qualifiers
FT   CDS             join(complement(1308694..1308928),
FT                   complement(1307935..1308610),complement(1307578..1307836))
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750021"
FT                   /orf_name="AFUA_4G04660"
FT                   /product="Proteasome regulatory particle subunit Rpt6,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL84614.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000051FFBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J9"
FT                   /transl_table=1
FT                   /translation="MALDNYYRNKIESMKLEIIQGQAVLRRLEAQRNDYNSRVRLLREE
FT                   LGLLQQPGSYVGEVVKVMSTKKVLVKVHPEGKYVVDIADGVDITKLTVGKRVALLSDSY
FT                   KLEKMLPSSVDPLVSLMMVEKVPDSTYDMIGGLDQQIKEIKEVIELGLKHPELFESLGI
FT                   AQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSELVQKYIGEGSRMVRELFVMAR
FT                   EHAPSIIFMDEIDSIGSSRIDSAGSGDSEVQRTMLELLNQLDGFEPTKNIKIIMATNRL
FT                   DILDPALLRPGRIDRKIEFPPPSVEARADILRIHSRSMNLTRGINLTKIAEKMNGCSGA
FT                   ELKGVCTEAGMYALRERRVHVTQEDFDLATAKILNKHDDKEVAVSKLFK"
     MALDNYYRNK IESMKLEIIQ GQAVLRRLEA QRNDYNSRVR LLREELGLLQ QPGSYVGEVV        60
     KVMSTKKVLV KVHPEGKYVV DIADGVDITK LTVGKRVALL SDSYKLEKML PSSVDPLVSL       120
     MMVEKVPDST YDMIGGLDQQ IKEIKEVIEL GLKHPELFES LGIAQPKGVL LYGPPGTGKT       180
     LLARAVAHHT DCRFIRVSGS ELVQKYIGEG SRMVRELFVM AREHAPSIIF MDEIDSIGSS       240
     RIDSAGSGDS EVQRTMLELL NQLDGFEPTK NIKIIMATNR LDILDPALLR PGRIDRKIEF       300
     PPPSVEARAD ILRIHSRSMN LTRGINLTKI AEKMNGCSGA ELKGVCTEAG MYALRERRVH       360
     VTQEDFDLAT AKILNKHDDK EVAVSKLFK                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page