(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE35

ASFUM1_4.PE35        Location/Qualifiers
FT   CDS             join(complement(119040..119894),complement(118224..118955))
FT                   /codon_start=1
FT                   /gene_family="HOG000216778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273689"
FT                   /orf_name="AFUA_4G00460"
FT                   /product="Chlorohydrolase family protein, putative "
FT                   /EC_number="3.8.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="EAL84372.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054160"
FT                   /db_xref="HOGENOM:HBG324149"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000051EB2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W969"
FT                   /transl_table=1
FT                   /translation="MSTEMLLTKMSTKILLCLQLFLYAGICLAKASILFQDAAAVISFD
FT                   KTSETLRVIRNASVLVTGDTIAAIMPASEHLQRPANTTVIPSDGKIITPGFVDTHRHAW
FT                   QTAFKTLGSNTSLAEYFARYSEFSPAKKIFTPEDVYIGQLTGLYESLNSGVTSILDHAH
FT                   HTWSSETALAGLRASVDSGARTWWCYAFHNLSDATWASNYTREDQIADFLRIAEHGPWR
FT                   KSDTVSLGIAYDNFALEDAAEIEQITSLALYEASSIEIRRADFISGRKTFLHSQYTTLA
FT                   VLGVYNFLNTSIPIVFSHASYLTVKDAELLRSTNQYISITGESERHYGHDHPSSPYIMD
FT                   QSSLGIDTHFTYSADIVGQARMWLQEVRLRLYAQVLDCWDIPPNNPMSVEQAFLLATRA
FT                   GGLALRRPDIGVLVEGAKADLVVFDGTSPNMLGWVDPVAAVILHSNPGDVEHVLVNGEF
FT                   RKRDFKLVVPGNLAEIQQRFLASARRIQEVWKQMPLPVLEGSFPNTPGVNYSKAVTADV
FT                   VRGWQNGYLSS"
     MSTEMLLTKM STKILLCLQL FLYAGICLAK ASILFQDAAA VISFDKTSET LRVIRNASVL        60
     VTGDTIAAIM PASEHLQRPA NTTVIPSDGK IITPGFVDTH RHAWQTAFKT LGSNTSLAEY       120
     FARYSEFSPA KKIFTPEDVY IGQLTGLYES LNSGVTSILD HAHHTWSSET ALAGLRASVD       180
     SGARTWWCYA FHNLSDATWA SNYTREDQIA DFLRIAEHGP WRKSDTVSLG IAYDNFALED       240
     AAEIEQITSL ALYEASSIEI RRADFISGRK TFLHSQYTTL AVLGVYNFLN TSIPIVFSHA       300
     SYLTVKDAEL LRSTNQYISI TGESERHYGH DHPSSPYIMD QSSLGIDTHF TYSADIVGQA       360
     RMWLQEVRLR LYAQVLDCWD IPPNNPMSVE QAFLLATRAG GLALRRPDIG VLVEGAKADL       420
     VVFDGTSPNM LGWVDPVAAV ILHSNPGDVE HVLVNGEFRK RDFKLVVPGN LAEIQQRFLA       480
     SARRIQEVWK QMPLPVLEGS FPNTPGVNYS KAVTADVVRG WQNGYLSS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page