(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE353

ASFUM1_4.PE353       Location/Qualifiers
FT   CDS             complement(1319287..1320123)
FT                   /codon_start=1
FT                   /gene_family="HOG000048675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206594"
FT                   /orf_name="AFUA_4G04700"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84618.1"
FT                   /db_xref="HOGENOM:HBG054467"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052043E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J5"
FT                   /transl_table=1
FT                   /translation="MLLNLPPELIQLVLQSSTTPSFLQVAFSCRTLYEIASSSREVILH
FT                   HLHKTPGLKVDTHSLKTRQLFQLLMKRSFQQLYGAQFSAKCTTFCFEHFALDARASSLA
FT                   SHGDRDIALALKGRQDVYVLQAKDGKLHLKAQLRSSEDQQGRIEVLKTAFDREGGVNVL
FT                   YRLVPAMDEDGFGATHPFVRHAIQSGPRVTVYMARHSLQTPNEPIRVCAFPDHAEYEPL
FT                   ALAAAGESTFAISWQHFRESDDYEVVLYNSPKQSSSNTPGVIGTLRFSAVLVHPVL"
     MLLNLPPELI QLVLQSSTTP SFLQVAFSCR TLYEIASSSR EVILHHLHKT PGLKVDTHSL        60
     KTRQLFQLLM KRSFQQLYGA QFSAKCTTFC FEHFALDARA SSLASHGDRD IALALKGRQD       120
     VYVLQAKDGK LHLKAQLRSS EDQQGRIEVL KTAFDREGGV NVLYRLVPAM DEDGFGATHP       180
     FVRHAIQSGP RVTVYMARHS LQTPNEPIRV CAFPDHAEYE PLALAAAGES TFAISWQHFR       240
     ESDDYEVVLY NSPKQSSSNT PGVIGTLRFS AVLVHPVL                               278
//

If you have problems or comments...

PBIL Back to PBIL home page