(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE358

ASFUM1_4.PE358       Location/Qualifiers
FT   CDS             join(complement(1335506..1335741),
FT                   complement(1335371..1335449),complement(1334809..1335306))
FT                   /codon_start=1
FT                   /gene_family="HOG000234964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260048"
FT                   /gene_name="csm3"
FT                   /orf_name="AFUA_4G04745"
FT                   /product="Chromosome segregation in meiosis protein 3 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="replication fork protection "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27200.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="UniParc:UPI0000F51AC0"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4DA84"
FT                   /transl_table=1
FT                   /translation="MENEGTLQDDRPASPKHAGDLFDYDFALDELWQETPNMPNNGAPM
FT                   QASARDESGLGLGLDEEVKVTKKRQPVAKLDESRLLSQPGIPKLRRTAKKKLRFKGKGH
FT                   EFSDAARLLNFYQLWLDDLFPRAKFADGLAIIERLGHSKRLQAMRKEWIDEEKPKDASE
FT                   NHNDVLKASESSGSQSDDPVVAFGGLNMADTKRSKGDIAGDYTSDAERMRVEVNLNPSG
FT                   QRKLDEGLFMTDNDDVAQQPDNLGAPDDDELDALLKEQELLLMNNASA"
     MENEGTLQDD RPASPKHAGD LFDYDFALDE LWQETPNMPN NGAPMQASAR DESGLGLGLD        60
     EEVKVTKKRQ PVAKLDESRL LSQPGIPKLR RTAKKKLRFK GKGHEFSDAA RLLNFYQLWL       120
     DDLFPRAKFA DGLAIIERLG HSKRLQAMRK EWIDEEKPKD ASENHNDVLK ASESSGSQSD       180
     DPVVAFGGLN MADTKRSKGD IAGDYTSDAE RMRVEVNLNP SGQRKLDEGL FMTDNDDVAQ       240
     QPDNLGAPDD DELDALLKEQ ELLLMNNASA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page